KEGG   Minicystis rosea: A7982_12239Help
Entry
A7982_12239       CDS       T04613                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mrm  Minicystis rosea
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrm03016]
    A7982_12239
Enzymes [BR:mrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     A7982_12239
Transfer RNA biogenesis [BR:mrm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    A7982_12239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: APR86890
UniProt: A0A1L6LYK6
Position
complement(13988918..13989625)
Genome map
AA seq 235 aa AA seqDB search
MSLLTLIHRDDRLAAFSKASGLLVHRGWGNDDIVAVELARAATGVRVFPVHRLDRATSGV
LLFALDAECAAALGRAFEEGAIHKTYLALVRGVAPEAGVIDNPVPKSEDGPRVPAVTAFR
RRHAGERWSLVEAEPRTGRLHQIRRHLKHISHPIVGDVNYGKGDINRLFRERFGLRRLAL
HAAALRFRHPFSGEAMTLHADIPADLAEPFAQMGIPESALAAAPASEGETRRDAT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcctgaccttgatccaccgagacgatcgcctcgcggcattttccaaagcgtcc
gggctgctcgtccatcgtggttggggcaacgacgacatcgtcgcggtcgagctcgcccgc
gcggccaccggcgtgcgcgtgttccccgtgcatcggctcgatcgcgcgacgagcggcgtg
ctcctcttcgcgctcgacgccgaatgcgccgccgcgctcggccgcgccttcgaggagggc
gcgatccacaagacgtatctcgccctcgtgcgcggcgtggcgccggaggccggtgtcatc
gacaacccggtgccgaagagcgaagacggcccgcgcgtccccgccgtcaccgcatttcgc
cggcgccacgcgggcgagcgctggtcgctcgtcgaggccgagccgcgcaccggccggctc
catcaaatcaggcggcacctcaagcacatcagccaccccatcgtgggcgacgtcaactac
ggcaagggcgacatcaaccggctcttccgcgagcgcttcggcctgcgccgcctggcgctg
cacgccgcggcgctccgctttcgtcatccattctcgggagaggccatgacccttcacgcc
gacatcccggcggacctcgccgagccgtttgcgcaaatgggtattccggagagcgctttg
gcggccgcgccggcgagcgagggagagactcgccgcgacgctacttga

DBGET integrated database retrieval system