KEGG   Minicystis rosea: A7982_12321Help
Entry
A7982_12321       CDS       T04613                                 

Definition
(GenBank) 6-hexanolactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mrm  Minicystis rosea
Pathway
mrm00903  Limonene and pinene degradation
mrm00930  Caprolactam degradation
mrm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A7982_12321
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    A7982_12321
Enzymes [BR:mrm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     A7982_12321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Peptidase_S15
Motif
Other DBs
NCBI-ProteinID: APR86972
UniProt: A0A1L6LZ20
Position
14074608..14075582
Genome map
AA seq 324 aa AA seqDB search
MPIVTRFLSALAGTAVDRMRRGPLRPSWSFMFEASIAFLRRTGRLASGRPPLEQRAVWEA
LRPPPDPVMKRVRRTPVDAGGIPAEWFEPIDGHGDAVVLFLHGGSFIYGSIASHAEMIAR
IALAAGARVLALSYRLVPEAVFPAPIDDTLTAYRWLLGQGVAPGRIVLAGDSAGGNLSLA
ALLAMRDRGEPLPAGSVPICPWVDPPRTGGSLDENQRFDWGFADDFAKWCAFYAGDADPA
QPLISPIRADLSGLPPLCILWGECEMLRDQVTELVTRAREAGLDVTAQEHPDMVHNWLTL
HALTPEAERAFTTIGSFVKRVTAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgtcacgcgcttcctctccgccctcgcagggacggcggtggatcgcatgcgc
cgcggcccgctccggccctcgtggtcgttcatgttcgaggcgtcgatcgcgttcctgcgc
cgcaccggcaggctcgccagcggccgcccgccgctcgagcaacgcgccgtgtgggaagcc
ctgcgcccgccgcccgatccggtgatgaagcgcgtgcgccgcacgcccgtggacgccggc
ggcatccccgccgaatggttcgagcccatcgacggccacggcgacgccgtcgtgctcttc
ctccacggcggcagcttcatctacggatcgatcgcctcgcacgccgagatgatcgcgcgc
atcgccctcgccgccggggcgcgcgtcctcgcgctctcgtatcgcctcgtgcccgaggcc
gtctttcccgcgccgatcgacgacaccctgaccgcgtatcgatggctcctcggccaaggc
gtggcgccgggccgcatcgtgctcgcgggcgactcggcgggcggcaacctcagcctcgcc
gcgctgctcgcgatgcgcgatcgcggcgagccgctccccgccggctcggtccccatctgc
ccgtgggtggacccgccgcgaaccggcggctcgctcgacgagaaccagcgcttcgactgg
ggcttcgccgatgatttcgcgaagtggtgcgccttctacgccggtgacgccgaccccgcg
cagccgctcatctctcccatccgcgccgatctctccggcctcccgccgctctgcatcctc
tggggcgaatgcgagatgctccgcgatcaagtgaccgagctcgtcacccgcgcacgcgaa
gccggcctcgacgtcaccgcacaggagcaccccgacatggtgcacaactggctcacgctc
cacgccctcacccccgaagccgagcgcgccttcaccaccatcggctccttcgtgaaacgc
gtgaccgcgggctga

DBGET integrated database retrieval system