KEGG   Melioribacter roseus: MROS_0017Help
Entry
MROS_0017         CDS       T02176                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mro  Melioribacter roseus
Pathway
mro00051  Fructose and mannose metabolism
mro00520  Amino sugar and nucleotide sugar metabolism
mro01100  Metabolic pathways
mro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MROS_0017
   00520 Amino sugar and nucleotide sugar metabolism
    MROS_0017
Enzymes [BR:mro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MROS_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer IspD ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AFN73261
UniProt: I6ZZV9
Position
complement(16499..17566)
Genome map
AA seq 355 aa AA seqDB search
MNLYAVIMAGGVGSRFWPRSKERKPKQLLRIFGENTMIQDTVNRLDGLVKNENIYVITNK
IQKMRVVEQLPQIPQENIIDEPFGKNTAACIGLASILIKQRDPEAVTLILPSDHLIKDDD
AFRKCLSTGADFAYKNKGLVTIGIKPTRPETGYGYIQFDEKEVSPDIYKVLTFAEKPNLS
TAKRFIESGDFLWNAGIFVWRVDTILEEIKTYLPDLYEGLLEIEKAIGSNDFAKQLTYVY
GQLKSISIDYGVMEKSKNVYLTKAEFYWNDVGSWEAVYEISEKDEDGNVLIGDIFSEYSY
NSYVFSPKKFTALIGAENLIVINTKDALLVCSRDKAQNVRDVVDYLKMNKRSELL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacgctgtaataatggctggtggtgtcggttcacgtttctggcccagaagc
aaagaaagaaagccgaaacagttactaagaattttcggtgaaaacactatgatccaggat
actgtgaaccggctcgacggtttggtgaaaaacgaaaatatttatgtaattaccaacaag
attcagaaaatgagggttgtggaacaactgccgcaaattccacaggaaaatattatcgac
gaaccgttcggtaagaatacggcagcttgtataggactcgcctcaatcctgattaaacag
agggatcctgaagccgtaacgttgattctgccttccgatcatttaattaaagacgacgat
gccttcagaaaatgtctttctacaggagcggactttgcttataagaacaaaggacttgta
accatcggcattaaaccgacgcgcccggaaaccggttacggatatatccagttcgacgag
aaagaagtaagcccggacatttataaagtgttgacgtttgcggagaaaccgaatctctcc
accgcaaagagatttatcgaaagcggcgacttcctctggaatgctggcatatttgtatgg
cgcgtcgatactattcttgaagaaataaagacttacttacccgacctgtatgagggcctg
ctcgaaatcgaaaaagcaatcggctcgaatgattttgctaagcagttgacttacgtttat
ggacaactgaaaagcatttctatcgattacggcgtaatggaaaaatccaaaaatgtttac
cttacaaaagcggaattttattggaacgacgtcggcagctgggaagctgtgtatgaaatc
tctgaaaaggacgaagacggcaatgtgttgataggggatattttttcggagtattcgtac
aattcttatgtcttttctcctaaaaagttcacagcccttatcggcgcggaaaatctgata
gttatcaatacaaaagacgcattgttggtttgcagcagagacaaagcgcaaaacgtaagg
gatgtcgtcgattaccttaaaatgaataaaaggtccgaacttttatga

DBGET integrated database retrieval system