KEGG   Melioribacter roseus: MROS_0094Help
Entry
MROS_0094         CDS       T02176                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mro  Melioribacter roseus
Pathway
mro00430  Taurine and hypotaurine metabolism
mro00620  Pyruvate metabolism
mro00640  Propanoate metabolism
mro00680  Methane metabolism
mro01100  Metabolic pathways
mro01120  Microbial metabolism in diverse environments
mro01200  Carbon metabolism
Module
mro_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MROS_0094
   00640 Propanoate metabolism
    MROS_0094
  09102 Energy metabolism
   00680 Methane metabolism
    MROS_0094
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MROS_0094
Enzymes [BR:mro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     MROS_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFN73338
UniProt: I6ZW91
Position
complement(120994..122172)
Genome map
AA seq 392 aa AA seqDB search
MKILIANPGSTSYKCKLYDAGNMDILFQAVVEKIGQKDAIFRYAFKEEKEITNNLEIKDY
LTAVNMTLKALNEKYSADEISAVGFKTVHAKGISGCVELTEEVIAAMKEYRPLAPVHTDV
YLTAISIFKDLLDTVPLVGLFETHFHKNIPPEAYMYGIPYEYYEKHGIRKYGFHGASHRY
IAMRAKELFDCNKVISCHLGGSSSVCAIKNGVSVDTSMGMSPQCGLINAKRVGDLDSYAL
LYLMQKESLSIDDAIEILMTKGGLYGISGIKSGDLRDIESEMGKGNYRAKLAFDTFVYNV
KRYIGEYLAILNGADCIVFTAGGGQNSVLLRKKIAENMENLGVILDDRKNESNPKEGLIS
NDASPVKLAIIPTNEEFIVASEVKEFLNKHNS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaattgctaatccgggaagcacttcatacaagtgcaaactatacgacgcc
ggcaatatggatattttattccaggcggtagtcgaaaagataggtcaaaaggacgctatt
ttcagatatgctttcaaggaagaaaaagaaataacgaataatcttgaaattaaagattat
ttgacagcggtcaatatgaccttaaaagcgcttaacgaaaaatattctgcggatgaaatt
tccgctgtcggttttaaaaccgttcatgcaaaaggaatttccggctgcgtggaactgacc
gaagaagtcatagcagccatgaaagagtatcgccctctggctccggttcataccgacgta
tatttgactgcaatatcgattttcaaggatttactcgatacggttcctctggtcggattg
ttcgaaactcactttcataaaaatattcctccggaagcctacatgtacggaataccgtat
gaatattacgaaaagcacggtataagaaaatacggattccacggcgcgtcgcaccgttat
attgctatgcgcgcaaaagaactgttcgattgcaacaaagttatttcatgccatctcggc
ggcagttcttctgtatgcgctattaagaacggcgtatcggtcgatacttctatgggcatg
agtcctcagtgcggactgattaacgccaaacgcgttggcgacctagattcgtatgcgctc
ctttatcttatgcaaaaagaaagtctttctatcgacgatgcaatcgaaatattgatgacc
aaaggcgggctctacggcatctcaggcattaaatcgggcgacctgagagatatcgagtcg
gaaatggggaaaggcaattaccgtgcgaaactcgctttcgatacttttgtctataatgta
aagaggtatatcggcgagtatctggcaattctaaacggcgccgattgtattgtatttacc
gccggaggagggcaaaacagcgttttgttgagaaaaaagatcgcggaaaatatggaaaat
ctcggcgtgattctcgacgaccgtaaaaacgaatcgaatccgaaagaaggattgatatcg
aacgacgcctcgcctgttaaacttgcaattattcctactaacgaagagttcatcgttgcg
tccgaagtcaaggaatttctgaataagcataattcgtaa

DBGET integrated database retrieval system