KEGG   Melioribacter roseus: MROS_2105Help
Entry
MROS_2105         CDS       T02176                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mro  Melioribacter roseus
Pathway
mro00480  Glutathione metabolism
mro00590  Arachidonic acid metabolism
mro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MROS_2105
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MROS_2105
Enzymes [BR:mro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MROS_2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFN75335
UniProt: I6Z837
Position
2473363..2473911
Genome map
AA seq 182 aa AA seqDB search
MFSKIIFLFFAFSLAFAQKGGSIYDFKVKDIDGKEVPLKDYKGKVLMIVNVASKCGFTPQ
YEALQKIYEKYQDRGFEILAFPCNDFKGQEPGTNEEIKEFCSANYHVTFRLFDKIHVLGD
NKAPLYNYLINSEGIEKGEVKWNFEKFIVDKNGKVAARFRSPVKPDSGEITDLIERLLSE
VN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtaaaataatatttttatttttcgcatttagcctggcttttgctcaaaagggc
ggaagcatttatgatttcaaagttaaagacatcgacggtaaagaagtaccgctcaaagat
tacaaaggaaaagtgttgatgattgtcaatgttgcaagcaaatgcggatttacgcctcaa
tacgaagctcttcaaaaaatctacgaaaaatatcaggatagaggttttgaaatacttgcg
tttccgtgcaacgatttcaaagggcaggaaccgggcacaaacgaggaaataaaagaattc
tgctctgccaattatcatgttacattccggttgttcgataaaattcatgtgctgggcgat
aacaaagcgccgctttacaattacctgattaacagcgaagggattgaaaaaggcgaggtt
aaatggaatttcgaaaaatttattgtcgataagaacgggaaagtagcagccaggttccga
agcccggtaaaaccggacagcggggagataaccgacttaatcgaaagattactcagcgaa
gtcaactaa

DBGET integrated database retrieval system