KEGG   Methylocystis rosea: EHO51_06835Help
Entry
EHO51_06835       CDS       T05721                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mros  Methylocystis rosea
Pathway
mros00450  Selenocompound metabolism
mros00970  Aminoacyl-tRNA biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EHO51_06835
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EHO51_06835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mros01007]
    EHO51_06835
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mros03016]
    EHO51_06835
Enzymes [BR:mros01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EHO51_06835
Amino acid related enzymes [BR:mros01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EHO51_06835
Transfer RNA biogenesis [BR:mros03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EHO51_06835
 Prokaryotic type
   Other AARSs
    EHO51_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Spore_III_AB
Motif
Other DBs
NCBI-ProteinID: AZG78541
UniProt: A0A3G8M9E0
Position
1411413..1412951
Genome map
AA seq 512 aa AA seqDB search
MISTAIPYANGAPHIGHAYERIATDAFARWKRLDGYDVLFVTGMDEHGQKMQRTAEKEGL
TPGALADRTAAQFARMGEALNARADDIVRTTQARHKETVLEMWRRMEANGDLYLSKYAGW
YSVRDEAYYDEDELTERDGKKFAPTGTPVEWVEEESWFFKLSAYAEKLLAHYAAYPHFIT
PEHYKNEIVAFVKRGLTDLSVSRTTFDWGIEIPPSAQTAAKHVMYVWVDALTNYVTATGY
LTEGGNRARFWPADAHVIGKDITRFHAIYWPAFLMSAGAPLPKQVVVHGFLFSKGEKMSK
SVGNVVDPIDLAERYGVDQLRYFFLREIPFGQDGNYSHEAIVNRINADLANDLGNLAQRS
LSMIAKNCMGAVPRKHALTDADKDILAQAADVLAKARAAMDDYAPHHALAEIFRIVAEAN
RYFAGEEPWAKKKSDPARMETILYVTAETLRRLAIPLQPFMPDSAGKLLDLLGVGPDERD
LAHADEANALQEGAPLPPPTPIFPRFVEEEAS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgacggccattccctatgcgaatggcgcgccgcatattggtcacgcctatgag
cgcatcgccaccgacgccttcgcgcgatggaagcggctcgacggctatgacgtgctgttt
gtcaccggcatggacgagcacgggcagaagatgcagcgcaccgccgaaaaggaagggctg
acgccgggggcgctcgccgaccgcacggccgcgcaattcgcccggatgggcgaagcgctg
aacgcccgcgccgacgacatcgtgcgcacgacgcaggcgcgccacaaagagaccgtgctc
gaaatgtggcggcggatggaggcgaacggcgacctctatctttccaaatacgccggctgg
tattcggtgcgcgacgaggcctattacgacgaggacgaactcaccgagcgggatggcaag
aaattcgcgccgacgggcacgccggtcgagtgggtggaggaggagagctggttcttcaaa
ttgtcggcctatgcggagaaattgctcgcgcattacgcggcttatccgcacttcatcacg
cccgaacactataagaacgagatcgtcgccttcgtgaagcgcgggctcacggacctctcg
gtgtcgcgcacgaccttcgactggggcatcgagattccgccgagcgcgcagaccgccgcg
aagcatgtgatgtatgtctgggtcgacgcacttacgaattacgtaacagctacaggatat
cttacggaaggcggaaatagagcacgtttctggccggccgacgcgcatgtcatcggcaag
gacatcacccgttttcacgccatctactggccggcgttcctgatgtccgcaggcgcgcct
ctgcccaagcaggtcgtcgtgcacggcttcctgttttccaaaggcgagaagatgtcgaag
tcggtcggcaatgtcgtcgatcccatcgatttggccgagcgctatggcgtcgaccagctg
cgctacttctttttgcgcgagatcccctttggccaggacggcaactattcgcacgaggcg
atcgtcaaccgcatcaacgccgatctcgccaatgacctcggcaatctcgcgcagcggtcg
ctgtcgatgatcgccaagaattgtatgggcgccgtaccacgtaaacacgcgcttacggac
gccgataaagacattctcgcgcaggcggccgacgttctcgcgaaagcgcgcgccgccatg
gacgattacgcgccgcaccacgcgctggcggaaattttccgtatcgtcgccgaggccaat
cgctatttcgccggtgaagagccctgggcgaagaagaagagcgaccctgcgcggatggag
acgattctctacgtcaccgccgagacgctgcgccggctggcgattcccctgcagccgttt
atgcccgactcagccggcaagcttctcgatctcctgggcgtcggcccggacgaacgggat
ttggcgcatgccgacgaggcgaacgccctgcaggagggcgcgccgctgccgccgccaacg
ccgatctttccgagatttgtggaggaggaagcgagttag

DBGET integrated database retrieval system