KEGG   Methylocystis rosea: EHO51_07230Help
Entry
EHO51_07230       CDS       T05721                                 

Gene name
glpX
Definition
(GenBank) class II fructose-bisphosphatase
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
mros  Methylocystis rosea
Pathway
mros00010  Glycolysis / Gluconeogenesis
mros00030  Pentose phosphate pathway
mros00051  Fructose and mannose metabolism
mros00680  Methane metabolism
mros00710  Carbon fixation in photosynthetic organisms
mros01100  Metabolic pathways
mros01110  Biosynthesis of secondary metabolites
mros01120  Microbial metabolism in diverse environments
mros01130  Biosynthesis of antibiotics
mros01200  Carbon metabolism
Module
mros_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mros_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHO51_07230 (glpX)
   00030 Pentose phosphate pathway
    EHO51_07230 (glpX)
   00051 Fructose and mannose metabolism
    EHO51_07230 (glpX)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EHO51_07230 (glpX)
   00680 Methane metabolism
    EHO51_07230 (glpX)
Enzymes [BR:mros01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EHO51_07230 (glpX)
    3.1.3.37  sedoheptulose-bisphosphatase
     EHO51_07230 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AZG76537
UniProt: A0A3G8M497
Position
complement(1494007..1494996)
Genome map
AA seq 329 aa AA seqDB search
MTQQPETDASKIDRYLTLELARASERAAVAAAKFRGRGDEMAADLAAAEAMREELSQLPV
RGRIVIGEGDEDAAPMLYIGEEIGAGVGPRVDLGVAALEGSTLCAKDMPGSMAVVAMAPA
GSLLHAPNVYMDKIAIGPGYPEGTIDLDRDPGDNIRALAIAKGVRASEITVSILDRPRHA
EIIRNCRIAGACVRLITDGDVAAIILTTHPFETGVDMYLGRGGASEGVLAACVLRCAGGQ
MQGRLALESRDQIAQAQRLGLLDPRRKYSVGDMAAGDVVVCVTGVTAGPLVGGVSLGKTT
IDTETIVYRSATGTIRRIHATHRAIGKFD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcagcctgaaaccgacgcgtcgaagatcgaccgctacctgaccttggagctg
gcgcgcgcctcggagcgcgccgcggtcgccgccgccaaattccggggacgcggcgacgag
atggccgccgacctcgcggcggcggaggcgatgcgcgaggagctgtcgcagcttcccgtg
cgcggccgcatcgtgatcggcgagggcgacgaggacgccgcgccgatgctctacattggc
gaagaaatcggcgcgggcgtcggtccccgcgtcgatctcggcgtcgctgcgctcgaaggc
tcgacgctttgcgccaaggacatgccgggctcgatggccgtcgtcgccatggcgccggca
ggatcgctccttcatgcgcccaatgtttacatggacaagatcgccatcggtccgggatac
cccgagggcacaatcgatctcgatcgcgaccccggcgacaacatcagagcgcttgcgatc
gccaagggcgtgcgggcgagcgaaatcacggtcagcattctcgatcggccgcgccacgcc
gaaatcatccgcaattgccgcattgccggcgcctgcgtgcgcctcatcaccgacggcgac
gtagcggcgatcattctcaccacccacccttttgaaaccggcgtcgacatgtatcttggc
cgcggcggcgcttcggaaggcgtgctcgccgcctgcgtcctgcgttgcgcgggcggccag
atgcagggacggctggcgctcgaatcgcgcgatcagatcgcgcaggcgcagcgtctgggc
cttcttgatccgcgccgcaaatattcggtcggcgacatggcggccggcgacgtcgtcgtt
tgcgtgaccggggtcaccgcggggccgctcgtcggcggcgtttcgctcggcaaaacgacg
atcgacaccgagacgatcgtctatcgctcggcgaccggcacgatccgccgcatccatgcg
acgcaccgggccatcggaaagttcgattga

DBGET integrated database retrieval system