KEGG   Methylocystis rosea: EHO51_11125Help
Entry
EHO51_11125       CDS       T05721                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mros  Methylocystis rosea
Pathway
mros00360  Phenylalanine metabolism
mros00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mros00790  Folate biosynthesis
mros01100  Metabolic pathways
mros01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EHO51_11125
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EHO51_11125
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EHO51_11125
Enzymes [BR:mros01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     EHO51_11125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AZG77245
UniProt: A0A3G8M7H6
Position
2296559..2297437
Genome map
AA seq 292 aa AA seqDB search
MGLQLASESKNRYAQAPRQADWTIDQNWASYSDEEHDRWNRLFARQAKLLPGRACDEFLE
AKQKLELSRSGIPEFADLTRRLGAMTGWSVVPVAGLIPDDAFFDHLANRRFPAGAFIRPE
SELEYLQEPDVFHDVFGHVPLLANPTYARFLEAYGKGGRRALARGQLHNLARLYWYTIEF
GLIETPKGLRIFGAGIMSSPSETIFSLEDSSPNRVAFNLERVMRTNYIISDFQQTYFVIE
SFEKLLADGYQDFDPIYDRLRDASDFAAHELAPADRIISRGDFHYFRAKRSA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggactgcaactcgccagcgaaagcaagaatcgatacgcgcaggcgccgcgacaggcg
gactggacgatagatcaaaattgggcctcgtacagcgacgaggagcacgatcgctggaac
aggctgttcgcccgccaggcgaagctcttgcccggacgggcctgcgacgaattcttggag
gcgaagcaaaagctcgaactgtcgcgctccggcattccggagttcgcggatctgacccgc
cgactgggggcgatgaccggctggagcgtcgtcccggtggccgggctgattcctgacgac
gccttcttcgatcatctcgccaatcggcgttttcccgccggggcattcattcgcccggag
tcggagctcgaatatctgcaggagcccgacgtcttccatgacgtcttcgggcatgtgccg
ctccttgccaatccgacgtatgcgcgctttctcgaagcctatggcaagggcggccgacgg
gcgctcgcgcgcgggcagctccacaatctcgcgcgactctactggtacacgatcgagttc
ggccttatcgagacgccgaaaggactgcgcattttcggggccggaatcatgtcctcgcct
tccgagacgatcttttcgctcgaagactcgtcgccaaaccgcgtcgccttcaacctcgaa
cgcgtcatgcgaacgaattacatcatcagcgatttccagcagacatattttgtcatcgaa
agcttcgagaagcttctcgccgacggttatcaggattttgatccgatctatgatcgcctg
cgcgacgcttctgactttgcggcgcatgagctcgcgccagcagaccgcatcatttcgcgc
ggcgatttccattacttccgcgccaagcgcagcgcttag

DBGET integrated database retrieval system