KEGG   Methylocystis rosea: EHO51_12185Help
Entry
EHO51_12185       CDS       T05721                                 

Definition
(GenBank) CoA ester lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
mros  Methylocystis rosea
Pathway
mros00630  Glyoxylate and dicarboxylate metabolism
mros00660  C5-Branched dibasic acid metabolism
mros00680  Methane metabolism
mros01100  Metabolic pathways
mros01120  Microbial metabolism in diverse environments
mros01200  Carbon metabolism
Module
mros_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EHO51_12185
   00660 C5-Branched dibasic acid metabolism
    EHO51_12185
  09102 Energy metabolism
   00680 Methane metabolism
    EHO51_12185
Enzymes [BR:mros01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     EHO51_12185
    4.1.3.25  (S)-citramalyl-CoA lyase
     EHO51_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: AZG77426
UniProt: A0A3G8M6D8
Position
complement(2530656..2531627)
Genome map
AA seq 323 aa AA seqDB search
MSFTLIEQATPRLHRSELAVPGSAPGMFEKAAQSKADQIFLDLEDAVAPDDKEQARKNII
QGLNDIDWGKKVMTLRINGLDTQYCYRDVVDVLENCPRLDIVLIPKVGVPADVYAIDMMI
TQIEQYKKRTKKIGIEILIETALGMANVEAIAQSSKRLEAMSFGVADYAASTRARTTVIG
GVNPDYGVLTDKDESGNREYYWADQWHAAQTRMMVACRAYGLRPIDGPFGDFGDPDGYIA
AAKRAAVLGYEGKWAIHPSQIELANQVFTPSDAEVTKARRILDAMTQAAKEGKGAVSLDG
RLIDIASIRMAEALIEKANAMAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcactttaatcgagcaggccacgccgcgtctgcatcgttcggaactcgccgtg
ccgggctcagcgccgggcatgttcgagaaggccgcgcagtcaaaggccgatcagatcttt
ctggatctcgaagacgccgtcgcgcccgacgacaaggaacaggcgcgtaagaacattatc
cagggcctcaacgatatcgactggggcaagaaggtgatgacgctgcgcatcaacggtctc
gatacgcaatactgctatcgcgacgtcgttgacgttctcgagaactgcccgcgcctcgac
attgtgctgatcccgaaggtcggggttccggccgacgtctacgcgatcgacatgatgatc
acgcagatcgagcagtacaagaagcgcaccaagaaaatcggcatcgaaatcctgatcgag
accgcgctcggcatggccaatgtcgaggccatcgcgcaatcgtcaaagcgccttgaggcc
atgtccttcggcgtcgccgactatgcggcgtcgacccgcgcccgcacgaccgtcatcggc
ggcgtcaatccggattacggcgtgctgaccgacaaggacgagagcggcaatcgcgaatat
tactgggccgatcagtggcatgcggcgcagacgcgcatgatggtcgcctgccgcgcctac
ggcctgcgtccgatcgacggtcccttcggcgacttcggcgatccggacggctatatcgcc
gccgccaagcgcgccgccgtgctcggctatgagggcaagtgggcgatccatccctcgcag
atcgaactcgccaatcaggtcttcaccccatccgacgccgaggtcacgaaggcgcgccgc
attctcgacgcgatgacccaggccgctaaggaaggcaagggcgccgtctctctcgacggc
cgcctgatcgacatcgcctcgatccgcatggccgaggcgctgatcgaaaaggccaacgcg
atggcggcgtaa

DBGET integrated database retrieval system