KEGG   Methylocystis rosea: EHO51_17185Help
Entry
EHO51_17185       CDS       T05721                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
mros  Methylocystis rosea
Pathway
mros00860  Porphyrin and chlorophyll metabolism
mros01100  Metabolic pathways
mros01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EHO51_17185
Enzymes [BR:mros01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     EHO51_17185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 AAA_25 SRP54 CBP_BcsQ AAA_10
Motif
Other DBs
NCBI-ProteinID: AZG78324
UniProt: A0A3G8M9Y9
Position
3510180..3511061
Genome map
AA seq 293 aa AA seqDB search
MNIPIRKPVETDSFQVELDPAISIGAAKVFAIYGKGGIGKSTTSSNLSVAFSKLGKRVLQ
IGCDPKHDSTFTLTKRLAPTVIDALESVKFHSEELRVEDFVVEGYNGVMCVEAGGPPAGT
GCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFASPLQHAGRALIVTANDFDSI
FAMNRIVAAIRAKSKNYEVRLGGVIANRSVATNEIDRYNAAVGLRRVAHFPDLDVIRRSR
LKKSTLFEMEPSPELEAVQNEYLRLADELWNGYAPLDAAPMKDRDLFEFLGFD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaacattccgatccgcaagccggtcgaaaccgactcctttcaggtcgagctggatccg
gcgatcagcatcggcgccgcgaaggtcttcgccatctatggcaagggcgggatcggcaaa
agcacgacgtcgtcgaatctttccgtcgccttttcgaaactgggcaagcgcgtgctgcag
atcggctgcgatcccaagcatgattcgaccttcactctgaccaagcgcctcgcgccgaca
gtgatcgacgcgctcgaatccgtgaagttccattccgaggaattgcgcgtcgaggatttt
gtcgtcgagggttacaatggcgtgatgtgcgtcgaggccggcgggccgccggccggcacg
ggctgcggcggctatgtcgtcggccagaccgtgaagctcctcaaggagcaccatcttctc
gaagataccgacgtcgtcatcttcgatgtgcttggcgacgtcgtctgcggcggcttcgcc
tcgccgctgcaacatgccggccgggcgctgatcgtcacggccaatgacttcgattcgatc
ttcgccatgaaccgcatcgtcgccgcgattcgcgcgaagtcgaagaattacgaggtgcgg
cttggcggcgtcatcgccaatcgcagcgtcgcgaccaatgagatcgaccgctacaatgcg
gcggtgggcctcaggcgcgtcgcgcatttccccgatctcgacgtcattcgccgcagccgc
ctcaagaaatcgacgctctttgagatggagccatcgcccgagcttgaggcggtgcagaac
gaatatctacgcctcgccgatgagctgtggaacggctacgcgccgctcgacgctgcgccc
atgaaggatcgcgatctcttcgaatttttggggttcgactga

DBGET integrated database retrieval system