KEGG   Moniliophthora roreri: Moror_10554Help
Entry
Moror_10554       CDS       T03137                                 

Definition
(GenBank) cdc2 cyclin-dependent kinase
  KO
K04563  cyclin-dependent kinase [EC:2.7.11.22]
Organism
mrr  Moniliophthora roreri
Pathway
mrr04011  MAPK signaling pathway - yeast
mrr04111  Cell cycle - yeast
mrr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    Moror_10554
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Moror_10554
   04113 Meiosis - yeast
    Moror_10554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mrr03019]
    Moror_10554
Enzymes [BR:mrr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Moror_10554
Messenger RNA biogenesis [BR:mrr03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     Moror_10554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: ESK91828
UniProt: V2WY85
AA seq 405 aa AA seqDB search
MPPLGRLKDVIWEWNEDLFVDVIGEFNVPIKLCPSRPGHGTLRDASHLTVYNNSTQTFIL
PNSTFLFSSLFLSHSLSYLAYIFAGIQSHLTLGQTLRKNQKFFLALVIAFPMDRYTKLEK
VGEGTYGVVYKAKDNGTNEVVALKKIRLEAEDEGVPSTAIREISLLKELKDDNIVRLLDI
VHADQKLYLVFEFLDVDLKRYIEQGNQNRKPITLNIVKKFLYQLNSGLLYCHSHRILHRD
LKPQNLLIDRHDNLKLADFGLARAFGIPMRTYTHEVVTLWYRAPEVLLGGRHYSTAVDMW
SVGCIFAEMALQGHPLFPGDSEIDQIFKIFRIMGTPNEQGWPGVSQLPDYKSTFPQWSRQ
DLSKIVPTLDEDGIDMLKKTLTYDSAKRISAKRALVHPYFADYKP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccccattgggccgtttgaaagacgtgatttgggagtggaatgaggacctttttgtg
gacgttataggagaattcaacgttcccatcaaattgtgcccatcgcgcccagggcatggg
acgttacgtgatgcgtcacatttgacggtttataacaactcaacccaaactttcatcctc
cccaactccacctttctcttctcttccctttttctctcccattctctctcgtatctcgct
tatatattcgctgggattcaatctcatctaactctcggacaaactttacgcaaaaaccag
aaatttttccttgctcttgtcattgcattccctatggatcggtacaccaagcttgagaaa
gttggcgaaggtacctacggtgtcgtctacaaggccaaagacaatggtacaaatgaagtt
gtggcgttgaagaagattcggctcgaagcagaagacgaaggtgtccccagcactgcgatt
cgcgagatcagtctattgaaggaactaaaggacgacaatatcgtgcggctcctcgacatc
gttcatgccgaccaaaagctctatctggtatttgagttcttggacgtggacttgaagcga
tatatcgaacaaggcaaccagaaccgaaagcccatcacgctcaacatcgtaaagaaattc
ctttatcagctcaattctggactcctctattgccacagccacaggattttacatcgggat
ttgaagcctcagaatctccttattgatagacatgacaatctaaagctcgctgatttcgga
ctagcgcgggctttcggtatccctatgaggacatatacccacgaagtagtaaccttgtgg
taccgagcgccagaagtgctgctcggtggacgccactactctaccgcggtggatatgtgg
tcagtaggctgcatatttgcggagatggcgttgcaggggcaccccttgttcccaggtgat
tcggaaatagaccagatctttaagatattcagaatcatgggaacacccaacgaacaaggg
tggcccggtgtttctcaactcccggactacaagtcaaccttcccgcagtggtctcggcaa
gacctctccaagatcgtgcctacgctagatgaagacggcattgacatgctgaagaaaacc
ctcacttacgactcggccaagcgtatttcagctaaacgcgctctggtccacccatacttt
gccgattacaaaccatga

DBGET integrated database retrieval system