KEGG   Moniliophthora roreri: Moror_10900Help
Entry
Moror_10900       CDS       T03137                                 

Definition
(GenBank) choline dehydrogenase
  KO
K00108  choline dehydrogenase [EC:1.1.99.1]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00260  Glycine, serine and threonine metabolism
mrr01100  Metabolic pathways
Module
mrr_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Moror_10900
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.1  choline dehydrogenase
     Moror_10900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 Pyr_redox_2 FAD_binding_2 Lycopene_cycl HI0933_like DAO ApbA
Motif
Other DBs
NCBI-ProteinID: ESK87926
UniProt: V2X570
AA seq 615 aa AA seqDB search
MMHSLWTFFTVIIFALPLVSAELPQCDKSSDTGAEYDYVVVGAGAGGGPVAARLAENGYS
VLVLDAGHDPNNLNTTIPLYFIRAAEDPQLDLNYTLNEYPSDFPIQKNDQWYPRARGIGG
STLHNALINIIAATRPDFDGLASMFNDPTWSRDNMQEIFKRIEHNTNLGLPLPLEHGFGG
WLKTSLNPILDVLNPKYLDAQTLAFAAGLIADAPPILDLNSRVGDNAAGGTLVSYTIDEH
HNRSSVRERLLDVRNKNPGKLDFAMDTLVTKVLLCNGTEGVPTAYGVEYAPDAALPVALN
FQGKSDLQTKTVIAKREVIVSAGTFQSPQLLMLSGIGDRSHLEQHGIETVVNLPGVGTNL
QDHDEIAVIWRMKQNFSLLNGCTFGSDPDQDPCLKAWRDEGRANVYSFGPAFQAFTFKSN
PEYRDPDMITYVAPGFFPGFVRGFPELLTSPQNHNAVTAVNLKVRPSSRGTVRLTGSHPQ
DLLSINKMHFQAERGPQDVRDLREGVKKARKIMNSLLIKPFIQEEVFPGEQAASDEAIEK
HVYENIFGHHACCTNPMGVDGDENAVLDGNFKVRGVKNLRVVDASSWPVVPGYFVTTPIY
MMSEKAADVILKEAK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgatgcactctctctggacattctttaccgttattatcttcgccctcccactcgtttct
gcagagctccctcaatgtgacaagtcaagtgataccggcgccgagtacgactacgtggtc
gttggtgcaggtgcaggaggcggaccagttgctgctagattggctgagaacggatattct
gttttggttctggacgcaggtcacgatccgaataaccttaacacgactattcccctgtat
ttcattcgggcagcagaagacccacagctcgacttaaactacacactaaacgagtacccg
tccgatttcccaatccagaagaatgatcaatggtatcctcgtgcccgtggtatcggcggt
tctacccttcacaacgcgttgattaacattattgctgcaacccgccccgattttgacggt
ctcgcgtccatgttcaacgatccgacttggtctagggataatatgcaagagatctttaaa
cgtattgaacataacacaaatttgggccttccgctacctcttgagcatggctttggaggt
tggctcaagaccagcctgaatccaattctggatgtgctcaacccgaagtacctagacgcg
caaaccttggccttcgcagcagggcttatcgccgacgcccctcccatccttgatctcaac
agtcgagtgggtgataatgcagccggaggcacactagtcagctacacaattgatgaacat
cacaatcgttcgagcgttcgtgagagactgttggatgtccgaaataaaaatcctggcaag
cttgatttcgccatggacacgttggtgacaaaggtgttgctgtgcaacggcacggaaggg
gtgccaacggcctatggggtagagtatgcaccggatgcagctctgccggtggcgttgaat
tttcagggtaaatccgacttgcagacaaagaccgtgatagcaaagcgggaagttattgtt
agcgcgggaacattccaaagccctcagctgcttatgctttcagggataggtgacagatcc
catcttgagcaacatggcatcgagactgttgtgaaccttcctggtgtaggcaccaacctt
caagatcatgacgagattgcggtcatctggcgcatgaagcaaaacttttccctactcaat
ggttgtacatttggttcagacccagatcaggatccctgtctcaaggcgtggagagacgaa
gggagggcaaacgtctactcctttggacctgcgttccaggcatttacatttaagtcaaat
ccggagtatagagaccccgatatgataacttatgttgcacctggctttttccctggattt
gttcgaggcttccccgagttgttgacttcaccccagaaccacaatgccgtcacagcggtt
aatctcaaagtcagaccttcgtctagagggacggttagacttacaggatcacatccacaa
gatctactttccatcaacaagatgcattttcaagccgagcgagggccacaagatgtcagg
gacctgcgtgaaggggtcaagaaagcgaggaagattatgaattcgctgttgatcaagccg
ttcattcaggaggaagtattccctggtgagcaagctgcgagcgatgaggccattgagaag
catgtttacgagaatatctttggtcatcacgcgtgttgcacgaaccctatgggtgttgat
ggtgatgaaaacgccgttctcgatggcaacttcaaagttcgaggtgtcaagaacttgcgt
gtcgtggacgctagtagctggccggttgtgccgggatactttgttaccacgcccatttat
atgatgtcggagaaggctgcagatgtcattctgaaagaggccaagtag

DBGET integrated database retrieval system