KEGG   Moniliophthora roreri: Moror_11317Help
Entry
Moror_11317       CDS       T03137                                 

Definition
(GenBank) dihydroxyacetone synthase (formaldehyde transketolase)
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00680  Methane metabolism
mrr01100  Metabolic pathways
mrr01200  Carbon metabolism
Module
mrr_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Moror_11317
Enzymes [BR:mrr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     Moror_11317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ESK85302
UniProt: V2WUP7
AA seq 743 aa AA seqDB search
MADTELVISTIRCLVADLVQQYKGGHPGTAMGAAPIAVSLWRDVMRYNPRDPLWFNRDRF
VLSAGHACLFQYIMLHFTGYPIWTLDELKRYHSRNFQTSRAAGHPEIEQEVGIEVTTGPL
GQGIANSVGLAMAAKQLAAQYNKPSFEGLIDNIIWCFTGDGCIQEGVGQEAISMAGHLGL
DNLVLIYDANKITVDGHINACFTEDVPLRFKAADWNVITLDQMAISTAEAQVSAITDTLI
RAKQHKGQPTLVVIDTVIGYGSRKANTGPAHGQALGDDEVAYVKEQFGMSPADKFIVPQK
VYDHFAGIPAKGIAAQEEWNDLAARYAESYPSEYAELQRRLSGKLPDGWRDLLPRKDQLP
TAPQPTRKSSGIVVETLAPLFPDLVAGSADLLESTFVSWKGMVEFQKPDSGRGDFSGRQI
RYGIREFSMAAIANGLASYFPQIPGRDGGGILPIFSTFFMFMAYALPAIRMAALQRLRTI
AVATHDSIGIGEDGPTHQPIALAAFYRGLPNCRLWRPADAEETMAAWIDAISWTDDQIHR
TSPVVNGDGGHGALAGQGQGHSAGQGGPTLLCLSRQPVPLLEGSSREKAWRGAYTVWEST
PSTPRLVLIATGAEVARAVQVASELASSFPVRVVSAPCLSVFDSQPYAYRRETIPSTKSL
VVSIEAWGSFGWARYAHASVSMQGFGHSGPQADLFEFFGFGVNNVAKLVKEWVSKHTDEK
GRVVVPGVGEFEELLKGFVPGSA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacggaactcgtcatttctactattcgatgccttgtagccgacctggtccag
cagtacaagggtgggcatccaggaactgcgatgggtgctgctcccattgctgtgtcgctc
tggcgtgacgtgatgcgctataatcccagggatcctttatggttcaatcgcgacagattc
gtactatctgctggacatgcgtgtcttttccaatacatcatgctccactttactgggtat
cccatctggacgcttgacgagttgaaacgttatcactcccgtaactttcagacatcgcgt
gcagctggtcacccagagattgagcaggaggttggaattgaggttaccactggccctctg
ggtcaaggaatagccaactcagtgggcctagccatggcagcgaagcaattggcagctcaa
tataataaacccagcttcgaagggctcattgataacatcatctggtgctttactggtgat
ggatgtattcaagagggagtgggtcaagaagctatctccatggctggtcatcttggtctc
gacaacctcgttctcatttacgatgctaacaagatcaccgtcgatggacatatcaatgct
tgtttcactgaagacgtaccgctccgcttcaaggccgcagactggaatgtcatcactctt
gatcaaatggctatttcaaccgcagaagcgcaagtctcagcaatcaccgatactctcatt
cgtgcgaagcagcacaaaggccagccaaccctcgttgtcatcgatacagtcatcggatat
ggctcgaggaaggcaaacactggtcctgctcatggacaagctctgggagatgatgaagtc
gcctatgtgaaggagcaattcggaatgtcccctgctgacaagttcatcgttccgcagaag
gtgtatgaccatttcgctggtattcctgccaaggggatagctgcacaagaagaatggaac
gatctggctgcaagatacgctgaatcatatccatcagagtatgcagaactccagaggcgc
ctgtctgggaaactacctgatggatggagagatcttttgccaaggaaggatcaattacca
accgcaccccagccgacgaggaagagctcagggatcgtggtagagaccctcgcgccgctg
ttccctgatctagttgctggaagtgcggatctcttagaatcgacatttgtaagttggaag
ggaatggtggagttccaaaagcctgattctgggcgcggggacttctctggtcgccagatt
cgttatggtatccgcgaattcagcatggctgccattgcaaatggtctcgcttcatatttt
cctcagatacctggacgtgatggtggtggcattcttcccattttctcaacattcttcatg
ttcatggcctacgctctacccgcgattagaatggctgccttgcagcgtttgagaactatc
gcagtagcaactcatgactccatcggtattggtgaagatggtcccacacaccaacctatt
gccctagcagccttttaccgcggtttaccgaattgccgcttatggcggccagctgatgca
gaggagaccatggctgcctggatcgatgccatctcttggacggatgatcaaattcatcgt
acttcgccagtggtcaacggagatggtggtcacggtgcattagctggtcaaggacaaggt
cacagcgccggccaaggtggtccaactcttttatgtctttctcgtcaacctgtccccctg
ctggagggcagtagcagagaaaaggcctggcgaggagcttacacggtttgggagtcgaca
ccttcaacaccgcgccttgttctcattgcaactggcgctgaggtagcacgtgctgtccag
gttgcctcagaacttgcctcatccttccctgtgcgggtcgtttcagcaccttgcctatcc
gtgttcgactcacaaccatatgcgtaccgaagggagaccatcccttccaccaagtccttg
gttgtgtcaatcgaagcatggggttcgtttggctgggcaagatatgcgcatgcctctgtg
agcatgcaaggattcggacattcaggcccgcaagcagacttattcgagttctttggtttt
ggagtgaataatgtggcaaaattggtgaaagaatgggtgagcaagcacacggatgagaag
ggccgtgttgttgttcccggcgttggcgagtttgaggaactgttaaagggattcgtaccc
ggttcggcgtag

DBGET integrated database retrieval system