KEGG   Moniliophthora roreri: Moror_11856Help
Entry
Moror_11856       CDS       T03137                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K12736  peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8]
Organism
mrr  Moniliophthora roreri
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mrr03041]
    Moror_11856
   03110 Chaperones and folding catalysts [BR:mrr03110]
    Moror_11856
Enzymes [BR:mrr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Moror_11856
Spliceosome [BR:mrr03041]
 Complex C
  Other components
   PPlases
    Moror_11856
Chaperones and folding catalysts [BR:mrr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Moror_11856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-ProteinID: ESK87163
UniProt: V2WK21
AA seq 656 aa AA seqDB search
MSDANSEQQDASVLGKRPRADEAEFQNGDAAQNNVDDDSDDDLGPMPMPAGVEEGSSQKK
KRKVLPHEKLYLDHLPNTDQYYKSFMHRDTINYCVVTKTEFMITTSVDGHLKLWKKQETG
IEFVKLYRAHLQPITGVSASADGQLFATVSEDGTAKVFDVVNFDMINIIKLGYTPHACCW
VHGRGQAQGVLAVSDASSGIIRLYDGRGGDTPLETVHNLHRFPVHIMTYSDRYDTVVSAD
EGGFIEYWQPTEPFQLPKNVSGLWSYKSETDLYEFKKSKSTPTCITFSPDSSSFVTMSLP
DRQIRIFSFLSGKLTRKYDESLTAIQEMQQAGTAVYKVEDMEFGRRLAAERELELPGPDG
KIPGRWCNAIWDESGAFIIYGSLLGIKVVNSVTNRVVRLLGKDEVVRFMNLSVYQGAPSK
RAVTTVAMAASANPILAERAMRDPILFCTGFKRQRFYMFTRSEPEDNKSGDRDVFNEKPT
REEQSIAAAAPNTGMGGPSPLANAATIHTTLGDIHMRLFPQQAPKAVENFVGHARSGYFE
GIIFHRVIAKFMIQTGDPLGDGTGGTSVWGREFEDEFSDDLKHDRPYTVSMANAGPGTNG
SQFFITTTATPWLDKKHTVFGRVITGLEVIHAIENVKTNKVDKPYEDIKIINVDVE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgcaaattccgaacaacaagatgcttctgtacttgggaaacgtccaagagcg
gatgaagctgagttccaaaatggagatgctgctcaaaataatgtcgacgacgactcggat
gacgaccttggaccgatgccaatgcccgctggcgtcgaagaaggaagcagtcagaagaaa
aaaagaaaagtactacctcatgaaaaactatacctggatcacctccctaataccgaccaa
tactacaagagtttcatgcaccgggataccattaattactgcgtcgtgacaaaaacggaa
ttcatgatcaccacttctgttgacggacatctaaagctttggaagaaacaagaaacaggg
atagaatttgtcaaactttaccgagcacacctgcaaccaataacaggtgtctctgctagt
gcagatgggcaattatttgcgaccgtttctgaggatggaacagccaaggtcttcgatgtc
gtcaattttgacatgatcaatatcatcaagctggggtatacacctcatgcatgttgctgg
gtgcacggccgtggtcaagcccaaggggttctcgctgtctctgacgcttcctcagggatc
attagactatatgatggacgtggtggcgatactcccctcgagacagtacataatcttcat
cggtttcctgtccatattatgacgtacagtgacagatacgacacggttgtctcggcggac
gagggtggtttcatcgaatattggcaaccaacagaacctttccagttgcctaagaacgtt
tcgggtctgtggtcatataagagcgagacagatctttacgagtttaaaaagtccaagtcg
acaccgacgtgtatcacattttctcctgactcttcgtcctttgttaccatgtcgcttccc
gatcggcaaattcgaatattctcattcttgtctgggaagctgacgcgtaaatacgatgaa
tcattgactgccatccaagagatgcaacaagccgggaccgcggtctacaaggtcgaggac
atggagtttggaagacgcctggcagccgagcgcgaattggaattgcctggcccagacggt
aagatacctggacgatggtgcaacgcgatctgggatgaaagtggcgccttcattatctat
ggatcattgcttgggattaaagtcgtcaacagtgtcactaatcgcgtcgttcgattactt
ggtaaagatgaggtggtccgattcatgaacctcagcgtctatcaaggcgctccctctaaa
cgagccgttacaactgtggcaatggctgcttctgccaatcccatcctcgctgaacgtgca
atgcgcgaccccattctattttgtaccggcttcaaacgccagcggttctacatgttcacc
agatcggaacctgaagataacaaatctggagatcgtgatgtgttcaacgagaagcccaca
cgtgaggagcaaagtatagctgccgctgctcccaatactggaatgggtggtccatcaccc
ttggcgaacgcagctacgattcacactactctcggagacattcacatgcgactatttcct
caacaagctcccaaagccgttgaaaacttcgtgggacatgctaggagtggttactttgaa
ggcattatattccaccgtgtgatcgccaagttcatgatccaaacgggtgatccgcttggt
gacggtactggaggtacctcagtctggggtagagagttcgaggacgagttttccgatgat
ttgaagcatgatagaccgtacacagtcagtatggccaatgcaggacctggcacgaatggc
tcccagttcttcattactacgacagcaaccccctggctcgacaaaaagcacacagttttc
ggccgtgttattacagggctggaagttattcacgctatcgaaaacgtgaaaactaacaaa
gtggacaagccttatgaggacatcaagataatcaatgtcgatgtcgaatga

DBGET integrated database retrieval system