KEGG   Moniliophthora roreri: Moror_12370Help
Entry
Moror_12370       CDS       T03137                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00430  Taurine and hypotaurine metabolism
mrr00620  Pyruvate metabolism
mrr00640  Propanoate metabolism
mrr00680  Methane metabolism
mrr01100  Metabolic pathways
mrr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Moror_12370
   00640 Propanoate metabolism
    Moror_12370
  09102 Energy metabolism
   00680 Methane metabolism
    Moror_12370
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Moror_12370
Enzymes [BR:mrr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Moror_12370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ESK95872
UniProt: V2XQ62
AA seq 454 aa AA seqDB search
MPQKLVLSVNAGSSSLKISLYSVNRDNVHDPNAELVSLLLTASISGISSPPAKFSFKPAA
LDANAVKDSPTESIKDHASAFAHFVEYLRNEASIDANDVVHICHRIVHGGDYHDPVVINN
ETYHHIEKLSDLAPLHNGSALAVVKSCINDLPNANSIAFFDTAFHRSMPPHIASYPIDQA
TANKRGLKKYGFHGLSYAYILRSVSRFLERPPESLNLIVLHLGSGASVCAIQNGKSLDTS
MGLTPVSGLPGATRSGAIDPSLIFHYTNKAGRISHDPNVATNLHVTQAEHILNIESGWKC
LTGTTDFGAITQQVFSPSGADPENKQLTHDNAKLAFDIFTDRIVNYIGSYHLKLRGEVDA
LVFAGGIGEKSKELREFVGDWVGCIGYGSGGGTVGGGVDKELNTQVEQKDGAVIDISLRN
EKKGEAKEKRILVCRTDEQFEMAWQCAVEDQFWN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagaaattagttctttctgtcaacgccggctcctcatctctcaagatatctctc
tactccgtgaatcgtgataacgttcacgaccccaatgcggagctcgtctcactccttctc
actgcaagcatatccggcatatcttcacctcccgcaaagttctccttcaaaccagccgct
ctcgacgccaatgccgtgaaggattcaccaacagagtctataaaggaccatgccagtgct
tttgcccacttcgtcgagtaccttcgaaacgaagccagcattgatgcaaacgatgttgtg
cacatatgtcaccggatcgttcatggtggagattaccatgatccagtagtgatcaacaat
gagacttaccaccatattgagaaactctccgacctagcacctcttcacaatggctctgca
ctagccgtcgtcaagagctgcattaatgatctcccaaacgccaactccatcgcctttttc
gacaccgctttccatcgttctatgcctccacatatcgccagctatccaatcgatcaagct
accgctaataagcggggactcaagaaatacggtttccacggtttgagttacgcgtacatt
ctacgctccgtatcacgattcctggaacgccctcctgaatcccttaacctcatcgtgctc
cacctcggttctggtgcctcagtctgtgcaatccagaatggcaaatcactggatacctcg
atgggactcacgcccgttagcggactaccgggcgctacccgctcgggcgcaatagacccg
tctctcatcttccattacaccaataaagcaggacgaattagtcatgatccgaacgttgct
accaatttacacgttacacaagcagaacacattctcaacatagaatccggctggaagtgt
ctcaccggcactaccgatttcggggccataacacaacaagtgttctctccatcgggagca
gacccagaaaacaagcaactgacgcacgacaatgcgaaattggcattcgacatcttcaca
gatcggattgtcaactacattggatcatatcacctcaaacttcgtggagaggtagatgct
ttagtctttgctggcgggatcggcgagaagagtaaggagctgcgtgaattcgtcggtgat
tgggttgggtgtataggatatggtagtggtggcggaactgtgggaggtggtgtggataag
gagctcaacacgcaagtagagcagaaggatggcgcggttattgatatcagtctgaggaat
gagaaaaagggtgaggcgaaagagaagagaatcttggtctgccggacagacgagcagttc
gagatggcttggcagtgtgcagttgaagatcagttttggaattaa

DBGET integrated database retrieval system