KEGG   Moniliophthora roreri: Moror_14303
Entry
Moror_14303       CDS       T03137                                 

Definition
(GenBank) c-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00100  Steroid biosynthesis
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Moror_14303
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Moror_14303
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-ProteinID: ESK94667
UniProt: V2XLQ7
AA seq 438 aa
MSANSKKNANLNPRTTSYEFLGPPGALFITLAVPLTIYGLYFGCSEETGGCPPPNFSTYP
DRITLALSNPTFWKGLWDSKATAIYFGWYAFCVAAWAVLPGAEIEGTTMRTGEKKRYKIN
ALSTFLLALGITSGIIYNYGPGAFTFLYERWVGFATASILMATLQAIGVYVMSFREGKLL
ALGGNSGNFIYDFYIGRELNPSIGSFDIKSFNELRPGLILWTLIDISMACEQAVRRGGLA
NVTDSMWLVLLFQIGYVADALYNEPAIFTTMDITTDGFGFMLSIGDLAWVPFVYSLQARY
LAFNQRELGPVLTGLIFLVNGVGYYIFRASNGEKNDFRNGINPKNLQYFTTERGSKLLTS
GWWGRSRHPNYLGDLLMALAWSLPTGFETPITYFYVTYFTVLLVHRQRRDDENCEKKYGK
DWEKYKKMVPYRIVPYVY
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcggcaaattcaaagaaaaatgccaaccttaaccctcgcacaacctcttacgaattc
ctcggtcctccaggagctttgttcatcactctagcggtccctttgaccatttacgggctc
tattttggatgttcagaggaaacaggaggatgcccaccaccaaatttctcgacttatcct
gatcgcattactttggccttatccaatccgacattctggaagggactttgggactcgaaa
gccacagccatctactttggctggtacgcgttttgtgtagcagcgtgggctgtgcttcca
ggtgcagagattgaaggaacaacaatgagaacgggtgaaaagaaaaggtacaagattaat
gccctctcgactttcctcctcgctcttggtatcacatccggcatcatctacaattacggc
ccaggagcgtttacattcctttacgaacgatgggttggattcgctactgcctcaatcttg
atggctacattacaggccatcggagtctacgttatgtctttccgggaaggcaagctcctg
gctcttggtggaaactctgggaatttcatctacgatttctacattggtagagagttgaac
ccctccattggctcctttgacatcaagtctttcaatgagcttcgtcctggcttgatcctc
tggaccctcatcgatattagcatggcttgcgagcaggccgtgcgcaggggcggcctcgcc
aacgttactgattccatgtggctcgtcctacttttccagattggatatgtcgctgatgct
ttatacaacgaacccgccatctttaccacaatggacatcacaaccgacggtttcgggttc
atgctttctatcggtgacttggcctgggttccgttcgtgtactctctccaagccagatac
ctcgcgttcaaccaaagggaactcggtcctgttcttactggtctcatcttcctcgtcaat
ggcgtgggatactatatcttccgcgcctcaaatggcgagaaaaacgatttccggaatgga
ataaacccaaagaatttgcaatacttcactacggaaagaggatccaagcttcttacttcc
ggttggtggggaagatcgagacatcccaattaccttggcgatcttctcatggccctagcc
tggtcccttcccaccggatttgagacacccatcacatacttctatgtgacttactttacc
gtccttttggttcatcgtcagagacgggatgatgagaattgtgaaaagaaatatggcaaa
gactgggaaaagtacaagaaaatggttccctatcgcattgtcccctatgtatactag

DBGET integrated database retrieval system