KEGG   Moniliophthora roreri: Moror_1486Help
Entry
Moror_1486        CDS       T03137                                 

Definition
(GenBank) tyrosine decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00350  Tyrosine metabolism
mrr00360  Phenylalanine metabolism
mrr00380  Tryptophan metabolism
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Moror_1486
   00360 Phenylalanine metabolism
    Moror_1486
   00380 Tryptophan metabolism
    Moror_1486
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    Moror_1486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrr04147]
    Moror_1486
Enzymes [BR:mrr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Moror_1486
    4.1.1.105  L-tryptophan decarboxylase
     Moror_1486
Exosome [BR:mrr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Moror_1486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ESK93669
UniProt: V2YPR6
AA seq 517 aa AA seqDB search
MDIEQCVHKCYVLHNVDNLAINRFRKAGYQAIDTICDYYYSLRESKVPVVPPVQPGYLKS
LLPASAPQSGEEFSSIAEDYQKFIVPGYTPWQHPSFFAYFPSGFSFEGLLGDIYSSGAAN
PGFNWTASPACTELEVIVMDWAAQMLGLSPEFYNSSGKGGGCIQNTASEAAIVAIVAARN
SYQQAHPDVKLEELVIYTTTQTHSLGMKAGMILGLAVRAVVVKPEDNFALRGNTLRSALQ
EDIQAGKKPFILIATVGTTSSGAIDNLKEIKEVVKDYPDLRIHIDSAWLGIALVCPEFRE
MCYLGEINEIADSFCTNFHKWGLTNFDASTMWVRDRKSLNEALDYTPTFLRTAQGDAGTV
IDFRNWHLGLGRRYRSVKLWFVLRGFGIEGFQAHVRKSINLNNKFVELVQTSPIFKLVTP
PSFALSVFRIDPKPRRPDEDLVPDSSLNDINRLFFGRVTARSDILLTQTTLDGKFCVRLA
VGSTTTQEHHIQHAFDLVSHEATLALEAWQREQAEGR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgagcagtgcgttcataaatgttacgttcttcacaacgttgataaccttgcc
ataaataggtttaggaaagctggttaccaagccatcgataccatttgcgactattattac
tctctccgtgaatccaaggtccctgtcgttcctcctgttcaacctggctatctaaaatca
ttactccctgcgtctgcacctcaatccggcgaagaattttcttcgatagcggaagactac
caaaagttcatcgtacctggatacaccccttggcaacatccatcgtttttcgcctatttc
ccaagcggtttctcgttcgaagggcttctcggagacatttattcaagcggggcggcgaac
ccaggtttcaattggaccgcgagtccagcatgcaccgagttggaagtcatcgtaatggac
tgggctgcccagatgcttgggctgtctccggagttctacaattcttctggcaaaggggga
ggatgcattcagaacacagcatctgaagcagctattgttgccatcgtcgcagctcgcaac
agctaccaacaagcccaccccgatgtgaaactcgaagaactagtgatttataccaccact
cagacccactcccttggcatgaaggcaggcatgattttaggacttgccgttcgtgccgta
gttgtgaaacctgaagacaattttgcacttagagggaacactcttcgttcggcattacag
gaagacatacaagccgggaagaaaccatttatcctaattgctactgttggcactacatct
tcaggtgcgatcgacaatctcaaagagatcaaggaagttgtgaaagattaccctgacctt
cgtattcatatcgattcagcatggcttggtattgcgttagtttgccctgaattcagagaa
atgtgctacttgggcgaaatcaacgaaatcgccgactctttctgcaccaatttccataag
tggggccttaccaattttgatgctagcacaatgtgggttcgggataggaaatctctgaac
gaggctctggattatactccgactttcttgagaactgctcaaggcgatgctggcaccgtg
atcgactttaggaactggcatcttggcctcgggaggcgttatcgttcagtgaaattatgg
tttgttctgagaggctttggaattgagggcttccaggcgcacgtgcgaaagtccataaac
ctaaataacaagtttgtggaactggtgcagacttctcccattttcaagctcgtcacccca
ccaagtttcgctctttcagttttcagaatcgatccaaagcctcgaaggccggatgaagac
ttggttccggatagctccctcaacgacattaataggcttttcttcggacgggtcactgcc
aggagcgatattctcttgactcagactacgttggatgggaaattctgcgtgaggcttgcg
gttggatcaaccacgacgcaggaacaccatattcaacacgcgtttgatctcgtcagtcat
gaggcaacccttgctttagaggcctggcagagagagcaagctgagggtagatag

DBGET integrated database retrieval system