KEGG   Moniliophthora roreri: Moror_15985
Entry
Moror_15985       CDS       T03137                                 

Definition
(GenBank) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00910  Nitrogen metabolism
mrr01100  Metabolic pathways
Module
mrr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
mrr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Moror_15985
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     Moror_15985
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD Rieske_2 NIR_SIR Pyr_redox NIR_SIR_ferr Rieske Rubredoxin_C AAA_32
Other DBs
NCBI-ProteinID: ESK92732
UniProt: V2XG86
AA seq 1104 aa
MSTIADPHRTIFVVGLGMVGIAFIEKLLSLDEARRYRIVTCGEESHLAYNRVALTEYFQH
RSVEKLYLNPVEWYSQQDPERFEFHIGETCTRIDTATHTVITDKGRKFSYDYCVIASGSN
ATLPSYADLSLPGVFVYRNISDINSLLQFAGTKTTKCLRAAVIGGGLLGLEAAKAVYELE
TVEHVSIIIRGGFPLSRQLDDAGGEIVLRRIREMGVSVLTHTSVKAVRVGDDGLCRGLEL
QNGQLLEYDIVIFAIGITPRDELARVSGIACAEKGGVIIDDTLLTSAKDVFGLGECVRWR
DASYGLIAPGIEMADILSFNLTQETTDVGSFRPRKMNNPDLSTKLKLMGVDVASFGDFFA
EQRQLAQKLPPRTSTAQKDPIWPTIPIEVQTDSTEKVNDASAPKKRHHREGTVITSANDQ
YETVTYRDPFAGVYKKYIFSADGKHLVGGMMVGDTSDYVKLVAIVKKKKPLDVPPSQFIL
GARKGTEDDGADLDDDTTVCSCHNVTKGAIAKCVRETKDGAVTMDTIKKCTKAGTGCGGC
IPLVTNILKAEMKKAGQTVSNDLCPHFPRSRRDIFDIVRVRKLKTFDEVLAFAGTGKGLG
CEICRPAVASILSSLWNEHVMKPVHHQNQDTNDKFLANIQRNGTFSVVPRVAGGEITPEK
LIALGTVARKYNLYTKITGGQRIDLFGAQKPDLPSIWGELIEAGFESGHAYGKSLRTVKS
CVGTTWCRYGIGDSVGMAIQLEERYKGVRSPHKIKGGVSGCTRECSEAQSKESKSIDFGL
IATDKGWNVFVCGNGGANPRHATLLASDVPPSKVVKLLDRFLMYYIRTADKLTRTARWLE
EMEGGIEKLRKIIIEDELGICAELEADMSALVGSYFDEWKAILDDPEGRNRFKQFVNTDE
RRDQIEIIDQRGQQRPADWPKAIPPVALRTDDISSPKSSWTWKKMASCTDFSTTEAGVSS
VAVKYSDSQLAIFHVPARGYYATQQMCPHKRAFILEHGIVGDDPRSGEIYVSCPMHKKNF
GLSSGACLNDEAYSILTFDAKAEGDDIYVLLPEESELDQVIGTSKWMIRQATAKALNSGA
ESIEIVGPPSGDGGNSCGGGTLEW
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgagcactatagcagatccgcaccgcacaatttttgtcgtcggtttgggcatggtgggg
atagccttcatcgaaaaattattgagtctggatgaggccagacggtatcgcattgtaacc
tgtggtgaagaaagccatcttgcatacaaccgtgtcgccttgactgagtatttccaacac
cgctccgtcgagaagttgtatttaaatccagtcgagtggtactcacagcaagatcccgaa
agattcgagttccatatcggagaaacttgtacaagaatagacacagcgacgcatacggtc
atcaccgacaagggccgcaagttctcatacgattactgtgtcattgcttctggatccaat
gctacattaccttcatacgcggacctctcacttccaggggtttttgtttatcgtaatatc
agtgacattaatagtcttctccagtttgcgggcacaaagaccacgaaatgcctacgagca
gcggtcattggtggtggtcttctggggcttgaggcagcgaaagcagtgtatgagctcgag
actgtggaacatgtttctataattatccgcggtggctttccactctcccggcagttagac
gacgcaggcggcgaaatagttttgaggcgtattcgcgagatgggagtttcggtgttgaca
catacttctgtcaaagctgtacgtgtgggtgatgatggtctctgtcgaggtttggagctt
cagaatggacaactcctggagtacgatattgttatattcgccattgggatcactccccga
gacgaactcgcaagagtttctggaatcgcatgcgcagagaaaggtggtgtcatcattgac
gacacacttttaactagtgcgaaagacgtgtttgggctcggagagtgtgtacgttggcgg
gacgcatcgtatggactcattgcacctggaatcgaaatggcggatatactttcattcaac
ctaacacaggagactacagacgttgggtcattcaggcccaggaaaatgaacaaccccgat
ctctccacgaagctgaagttgatgggcgtcgacgttgcttcgttcggtgacttttttgct
gagcagcgccagctcgcacagaaattgccaccaagaacgtctacagcgcagaaggatcca
atctggccaaccattccgatagaagtacagacagattccactgaaaaggtcaacgacgct
tcagcaccaaagaaacgacatcatcgcgaaggcactgtcataacctcggccaatgaccag
tacgaaaccgtcacttatcgggaccccttcgctggcgtgtataaaaagtatatcttcagc
gccgatggaaagcaccttgtaggtggaatgatggttggcgatacttcagactatgtcaag
ttagtagcaatagtgaagaagaagaaacccctggacgttcctccatcgcagttcattcta
ggtgctcgtaaaggcacagaggacgacggtgctgatctcgatgacgataccacagtctgc
agttgtcataacgtgacgaaaggcgctattgccaagtgcgttcgagagaccaaggatggc
gctgtgaccatggacaccatcaagaagtgtacgaaggccggtactggatgcggagggtgt
attcctcttgtgaccaacatacttaaagccgagatgaagaaggccggacagacagtatcc
aacgacctatgccctcatttcccccgatcgaggcgagacattttcgacattgtgcgggtc
cgtaagttgaagactttcgatgaagtgcttgcctttgcagggaccgggaaaggtttgggc
tgcgaaatctgtcgaccagctgtggccagcatactttcgtctctgtggaatgaacatgtt
atgaagcctgtccaccaccaaaaccaggatacgaatgacaagttccttgcaaacatacag
cgtaatggaaccttctccgtcgtacctcgggttgctggcggggagatcaccccagaaaaa
ttgatcgcactcggaacggtcgcacggaaatataacctatataccaaaattactgggggt
caacgcattgacttgttcggggcgcagaaacctgacttaccctcgatatggggtgaactt
atcgaagcgggatttgaaagtggacatgcctatggaaaatctcttcgcacggtaaaatca
tgtgttggcacgacctggtgtagatacggcattggcgactctgttggaatggcaatccaa
ctcgaagaacggtacaagggtgtccgctcacctcacaagatcaaaggaggagtgtctggc
tgcacgagggagtgtagtgaggcacaatcaaaggaaagtaaatcaattgacttcggtctc
attgccacagataagggttggaacgtattcgtgtgcggtaacgggggtgctaacccccgg
catgctactcttcttgcatctgacgttcccccgtcgaaggtcgtcaagttgctcgacaga
ttcctgatgtactatattcggacagcggataaactaacccgtactgcgcgatggctggag
gaaatggagggaggtattgaaaagcttcggaaaatcattattgaggacgagcttggcatc
tgcgctgagctagaggctgacatgagcgccttggtcggctcctacttcgacgagtggaaa
gctattctggacgatcctgaaggtcggaaccggttcaagcaattcgtaaacacggacgag
cgtcgagatcaaattgaaatcattgaccaaagggggcagcaaaggccggcagactggcca
aaggcaattcctccagtggccttaagaacagatgacattagcagcccaaagagctcatgg
acctggaagaagatggcaagctgtaccgatttcagtacaaccgaggctggcgtatcgtcc
gttgctgtgaaatacagcgacagtcagcttgcgatattccacgtaccagcaaggggatat
tacgccacacaacagatgtgcccacataaacgcgcgttcatccttgaacatggtattgtt
ggggacgacccaaggagtggcgaaatatatgtgtcgtgtcctatgcacaagaagaatttc
ggactttcttctggtgcctgtctcaatgatgaggcatacagtatcctgactttcgatgct
aaagccgaaggcgatgatatatatgttcttcttcctgaagagtctgaacttgaccaagtt
atcgggacgagcaagtggatgattagacaagcaacggcgaaagctctgaacagcggggcc
gaaagcatcgagattgtaggaccgccgtcaggcgacggaggaaatagctgcggtggtggt
actttggaatggtag

DBGET integrated database retrieval system