KEGG   Moniliophthora roreri: Moror_2146Help
Entry
Moror_2146        CDS       T03137                                 

Definition
(GenBank) glycoside hydrolase family 35 protein
Organism
mrr  Moniliophthora roreri
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 BetaGal_dom2 BetaGal_dom3 Amidohydro_2 Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: ESK83683
UniProt: V2WA71
AA seq 1025 aa AA seqDB search
MATMRSTLLFLIQFALLFTSLTLSAARGIASRQEGPRPRTWTDQVDYDEYSLIIKGQRVF
LHSGEFMTYRLPVPDLWPDILEKFKAAGFNGLSLYTHMGSINPSRGVVDFESYRALKPLF
EAAKEFGVWVVLRPGPYINAETSAGGLAHWTTTEVKGKLRSNASDYREAWTPYILGIIRE
AVDYQITQGGPIIAVQVDNEYGQDPGAGYFEDLKAVYRNESNGIVVPLTYNDPGMGRSFI
NGTGAVDLYGFDAYPNRYDCAHPNIWRPVPENYHEYHMEANRWQPLYIPEYQGGSLQAWG
PNTPDYSGCAALTGPDFESVFYKQLWADNVKLVNYYPLYGGTSWGSIPFHGVYTSYDWGA
AISEPRILTTKYTELKLQGTFLRSSPEFYKTDVVANSTEIPIIDTLNSSSLGFATLLRNP
DTGAGFWIVRHNDSTSTAISEFKLNVTTASGASLQIPNIARAITLDGRQSKALVTDYAFG
SSRALYSTAEVFFAGVIDGRDVLFLHGYSNQEHEVVLSLTGTNTANATSEFIIYTPEPAL
ADLAPNSTLVSFRKGIQGLHTLHASDTQLVVFADTSTAETFWAPSIASNTSEHASFWGIG
TNQSVLVGGPYLVRSAHIEGDTLALRGDLNASNVKKESRLMIIAPRSITKVTWNEGIVLL
DDSSVDDGYITGTIELAEKAEITVPELDGWKYHDSLPEIGDEFDDSQWVVANHTETNVPF
KMWYGDGRVLYGCDYGYCEGAVVWRGHFNAAGAEKSMNLSINGGQGFAATVWLNDLFLDT
SFGNSSNGANNINETDQVFTFPDGSVRLGQDNVVTVVQDNMGLNENWYTDDHMKSPRGIR
GFQLNSGNFSEWKVQGKIGGYTNFPDKVRGVMNEGGLFGERKGWHLPDFDTSSWENRSLS
DGLPNAAAGVGFFVTKFILSIPGGYDVPISFNFDEPFGQPYRALLFVNGWNMGKRIGNLG
PQAKFPVHEGILNYQGENTVAVALWSMTPNVTVSPTLSLAADGVFNGGVGRIRTNNPAWM
QEGRE
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatgaggagtactcttctcttcttgatacagttcgcccttcttttcacctcc
ttgacgctctctgcggcgagaggtattgcttctcgtcaagaaggccctcgaccccgaacg
tggactgatcaggtggactatgacgagtatagtcttatcatcaaaggccagcgcgtcttt
ctgcactctggcgaatttatgacgtaccgtttaccagtacccgatctttggccagatata
ctcgaaaagttcaaagcggcaggtttcaatggacttagcctgtatacacatatgggctcg
atcaacccatcgagaggagtagtcgattttgagagctaccgggctctaaaaccgctgttt
gaagctgcaaaggagtttggagtttgggttgtattacggcctggaccctacatcaatgca
gagactagtgctggaggcctcgcacattggacgactactgaagtcaaaggaaagctccgc
tcgaatgcaagcgactaccgtgaagcttggacgccgtatattcttggtatcattcgcgaa
gctgtggactatcagatcactcagggtggacctatcatcgccgtacaagttgataacgaa
tacggtcaagatcctggagcaggatactttgaagatctcaaggccgtgtaccggaacgag
agtaatggaattgtcgttccgttgacgtataacgatcctggtatggggagaagctttatc
aacggaacaggtgctgtcgacctttacggtttcgacgcatatcctaatcgatacgattgt
gcgcatcccaacatttggaggccagttccggaaaactatcatgaatatcatatggaggcg
aataggtggcagcccttgtacatcccggaataccaaggaggatcgttgcaagcctggggt
cctaatacacctgactattctggttgcgcagccctcactggacccgattttgaatccgtg
ttctacaagcagctttgggcggataacgtcaagcttgtcaactattatcctctatacggc
ggcacatcttggggcagtattccattccatggtgtctacacctcgtatgactggggagca
gctatctctgaaccacgtattctcaccaccaaatacaccgaattgaagctacaaggcacc
ttccttcgaagttcacccgagttttacaaaaccgacgtcgtagccaactcgacagagatt
cccatcatcgatacgctcaatagctcttctctggggttcgccaccttactgaggaatcca
gacaccggtgcaggattttggattgttaggcataatgactccacttcaactgccatatca
gagttcaagctgaacgtcaccactgcatctggtgcatctctccagatacctaacattgca
agagccatcaccctcgacggtcgacaatccaaagccctcgttaccgactatgcctttgga
agctcacgagcgttatactctacagccgaggtattcttcgctggtgttatcgatggcaga
gatgtccttttcctacatggatactccaaccaggaacacgaagtggtcttgtcgcttacc
ggcactaacactgccaatgctacctcggaattcatcatctacacacccgagcctgcactc
gctgacttggcgcccaactcgaccctagtatcgttcagaaaaggcatacagggtcttcat
acccttcatgcctccgatacccagctcgtcgtattcgctgatacgtctaccgccgagacg
ttttgggcaccatcgatcgcctcaaacacctctgaacatgcgagtttctggggtatagga
accaatcagagtgtcttagttggaggtccgtacctcgttcgttccgctcatattgagggt
gatacgcttgccttacgtggggatctcaatgccagtaatgtgaagaaggagagcaggctt
atgataattgcaccgaggagcattacaaaagtgacctggaacgaggggattgtgttactc
gatgattcttcggtggatgacggatacattactgggacgatagagttggcggagaaggcg
gagattactgttccggagctggatgggtggaagtatcatgatagtcttccagagatcgga
gacgagtttgatgattcgcagtgggtggtagcgaaccatacggagaccaatgtaccattt
aagatgtggtatggagatgggcgggtattgtatggttgcgactatggctattgcgaaggt
gccgtcgtctggagaggccacttcaacgcagctggcgcagagaagagtatgaacttgtcg
attaacggaggtcaaggctttgctgctaccgtgtggctgaacgatctcttcctcgacaca
tcgttcggaaattcctcaaacggtgccaacaacatcaacgaaacagatcaagtctttaca
ttccccgatggttcagtgcgtctcggacaagataacgttgtcactgtagttcaggataac
atgggcttgaacgagaactggtacactgacgatcatatgaaatcgccccggggcattcgc
ggcttccagctgaacagtggaaactttagcgaatggaaggtccaaggcaagattggcgga
tacaccaacttcccagacaaggtccgcggtgtcatgaacgaaggcggtctattcggtgaa
cgcaagggatggcatctgcccgatttcgacacttcttcatgggagaatcgaagtctttcc
gacgggttaccaaatgctgctgcaggtgtcgggtttttcgttaccaagttcattttgagt
attccaggaggatatgacgtgcctatatcgttcaactttgatgagccctttggtcagcca
tatcgagcgttgctgtttgtcaatggatggaatatgggaaagaggattgggaatttgggg
cctcaggcaaagtttccagtacatgaaggaattctcaattatcaaggagaaaatacggtt
gctgttgcgctatggtccatgacgcctaacgtcactgtttcgccgacgttgagcttggct
gcggacggcgtcttcaatggcggcgttggaagaattaggacgaataatccagcatggatg
caagaaggccgggagtga

DBGET integrated database retrieval system