KEGG   Moniliophthora roreri: Moror_3831
Entry
Moror_3831        CDS       T03137                                 

Definition
(GenBank) c-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00100  Steroid biosynthesis
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Moror_3831
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Moror_3831
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-ProteinID: ESK95393
UniProt: V2X877
AA seq 440 aa
MAAAPKSSKQAPAVGLNPRTTEYDFFGPIGALTVTITVPIIVYALYFGCAEETGGCPPKF
ELQDLVSYFSREQWWKNLWDTEAAIAYLGWYAFCVVCWIILPGGTLKGAVLRDGSVKEYK
INGFATFMLAIGLAVGSIIKYGPESMTFIYHKWVGLCTAALIMSIVQAIYVYVMSFRPGK
LLALGGNSGNVIYDFFIGRELNPSIGSFDIMSFNELRPGLILWALIDISMICEQAVRRGG
FAKVTDSMWLASAFQIWYVADALYNEPALFTTIDIVTDGFGFMLSVGDLLWVPFTYSLQP
RYLVFNQLELGPLNTALIIGVNLLGYWIFRSANGEKNDFRNGKNPKNLKYMTTERGSKLL
ISGWWGISRHPNYIGDIIMALAWSLPTGFATPIPYYYPIYFTFFLMHRQSRDEAWCQKKY
GKDWDKYKEIVPYKIFPYIY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcggcagcacccaagtcgtcgaagcaggctcctgcagtggggctaaacccacgtacc
actgagtatgacttttttggtcccatcggcgcgctcaccgtcaccattaccgtccccatc
atcgtttacgccctctactttggatgtgctgaagaaactggaggctgcccacccaaattc
gagctacaagacttggtatcttacttcagtcgtgaacaatggtggaaaaacctgtgggac
acggaagcagcaatcgcgtaccttggttggtatgcgttctgcgtggtatgctggattatt
ctaccaggaggaacccttaaaggagcagtacttcgagatggaagcgtgaaagagtacaaa
attaatggtttcgctactttcatgctcgctattggactcgcggttggctccattatcaag
tacggaccggaatctatgacctttatctaccataaatgggttggcttgtgtacggctgcg
ttgattatgtccatcgtccaagctatctacgtctatgtcatgtcgttccgccccggaaaa
ctgcttgctctgggaggaaactctggcaatgtcatttacgactttttcatcgggcgagag
ctcaatccgtctattggctcgtttgacatcatgtcctttaacgaacttcgtccgggcctc
attctctgggctctcatcgacatctccatgatctgcgagcaggcagtccgccgtggtgga
ttcgcaaaggttacagattcaatgtggctcgcttcggctttccagatctggtacgtggct
gatgccttgtataatgagcccgcactattcacgactattgatattgtgactgatggtttc
ggctttatgctttccgttggagatctattatgggtgcctttcacgtactccctccaacct
cgataccttgtttttaaccagcttgaactgggacccttgaatactgcactcatcattggt
gtgaacctcctcggctactggatcttccgcagcgcgaatggagagaagaacgatttccgc
aacggcaagaaccccaaaaatctcaaatacatgaccactgagcgaggctccaagcttctc
atctccggctggtggggaatttcacgtcaccccaattatatcggcgatatcatcatggcc
ttagcctggtctctaccaacaggctttgcgacacctattccatactactacccaatctat
ttcaccttcttcctgatgcaccgtcaatctcgcgacgaggcgtggtgtcagaaaaaatac
ggcaaggactgggacaagtacaaagaaatcgtaccatacaaaatcttcccctatatttac
tga

DBGET integrated database retrieval system