KEGG   Moniliophthora roreri: Moror_4030Help
Entry
Moror_4030        CDS       T03137                                 

Definition
(GenBank) palmitoyltransferase pfa3
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
mrr  Moniliophthora roreri
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mrr04131]
    Moror_4030
Enzymes [BR:mrr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Moror_4030
Membrane trafficking [BR:mrr04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    Moror_4030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-ProteinID: ESK95272
UniProt: V2XNF3
AA seq 362 aa AA seqDB search
MPLVSFTNLPSSPPKHLDLPVDSDSSPRKWYHHLMLLGTALLIFAPHPSLLYFLLIHYLK
TLDSPIRFAFHLFVCYTLTFGAYTSLIVCVARDPGPTTSISENENENEGEDEMGLTEALL
SGHHDDDFNSPAKWCRKCWAPKYERTHHCSMCGRCVLKMDHHCPWLGSRCIGHRTYPAFL
HFLFCITLLSIYIASICASGVYWAFQHPWEADETMPLHAIALFFAGCLFTLVIGSFTVYH
VYLVSTNQTTIEHISPFLLLRYLPSHSQTRPIPEEHELSFPQRRLVKDAHGEIRMYDVGF
RQNWAQVFGIGTRGNNSWKWWLVRILCGGSSPGDGKTFPRSPRSEEMLARLASELGIVDR
ER
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccactcgtctccttcaccaacctcccttcgtctcctccaaaacatctagacttgcca
gtcgactcggactcttcaccacgaaaatggtaccaccacctcatgctcctcggaactgct
ctattaatcttcgctccccatccttccttactctactttctcctcattcattatctcaaa
acactcgattctcccatacgtttcgcattccatctattcgtttgttatacactcacattt
ggagcgtacacttctctcatagtatgtgtcgcaagggatcccggtcctacaacttccatt
tcggagaacgagaacgagaacgagggcgaggatgagatggggttgaccgaagctctatta
tccggacatcacgacgacgactttaattcacccgctaaatggtgtagaaaatgttgggca
ccgaaatatgaaagaacacaccattgttcaatgtgcgggaggtgtgttttgaagatggac
catcattgtccgtggttgggctcacggtgtatcggccaccgaacataccccgccttcctt
cactttctcttctgcatcacccttctaagcatatacatagcatccatatgcgcaagtggt
gtatactgggcctttcaacatccctgggaagcagacgaaacaatgcccctccacgcaata
gccttattctttgcaggatgcttatttactttggttataggcagttttacggtgtatcat
gtgtatctggtctcgactaatcaaacaactatcgaacatatctcaccgttcctacttctc
cggtatcttccttcccattcccaaacgcgaccgataccagaagaacacgaactgtcattc
ccccaacgaagactagttaaagatgcgcatggagagatacggatgtatgatgtcgggttt
agacagaattgggcgcaggttttcggaattggcacgagaggtaataatagctggaaatgg
tggctcgttagaatactctgcggagggtccagtccaggcgacggtaaaacattccctagg
agtccgaggagtgaggaaatgttggcgaggttggctagtgagttgggtattgtcgatagg
gagaggtag

DBGET integrated database retrieval system