KEGG   Moniliophthora roreri: Moror_4757Help
Entry
Moror_4757        CDS       T03137                                 

Definition
(GenBank) cellulose -beta-cellobiosidase precursor
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00500  Starch and sucrose metabolism
mrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Moror_4757
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     Moror_4757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-ProteinID: ESK92225
UniProt: V2XIA6
AA seq 548 aa AA seqDB search
MSSRAKCRMRSHEAQLVGSEHLPQNLARSIHCTVTLRLQGHVGHVAVRCAEFHSHLGSAT
VFGTSSSDIGIKASIEEHISSSVAQVSATMFPKASLLSLALFAIDASAQQAGTLTTETHP
KLTYQKCSAGGSCQTQQGSVVLDSNWRWLHTTSGSTNCYTGNEWDTSLCPDGATCAKNCA
LDGADYSGTYGITTSGNALTLKFVTHGPYSTNIGSRVYLMDSSDSKYQQFNLLNQEFTFD
VDMSNLPCGLNGALYFVSMAADGGVAGNNKAGAKYGTGYCDTQCPHDIKFINGEANVAGW
EPSPNDENAGKGQYGACCNEMDIWEANNNAAAYTPHVCRNTNGGQTRCSGNDCGDGDNRY
GGICDKDGCDFNSFRMGDKNFLGPGKTVNTNSKFTVVTQFITSNNSTSGTLKEIRRLYVQ
NGKVIQNSKTSISGMSAYDSITDQFCADQKKAFGDTPSFADRGGLTAMGNAFAKGMTLVM
SLWDDHEAEMLWLDSNYPLDKDASTPGVARGTCSSDSGDPKTVESQHPDATVIYSNIKYG
PIGSTYSH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtcgagccaaatgtcggatgaggtcgcatgaagcccagctcgtaggatccgaa
catctacctcaaaatttggcaagatcaatacactgcacggtcacacttcggttgcaaggt
catgttgggcatgttgctgttcgatgtgcagagttccattcacaccttgggtcggctacg
gtgtttggcacgagttctagtgatatcggtataaaagccagtattgaagagcacatttcc
tcatcggttgcccaggtatctgctacaatgttccctaaggcctccctcctctccctagct
ctttttgctatcgacgctagtgcccagcaagctggcactctcactactgagacacacccc
aaactcacgtaccagaagtgctctgctggaggtagttgccaaactcaacagggctccgta
gtactcgattccaactggcgttggttgcacacgacttctggctcgaccaactgctacaca
ggaaatgaatgggacactagtctctgccctgatggtgcaacttgcgcaaagaactgcgct
cttgatggtgccgattacagtggtacctatggtatcaccacatccggaaacgccctcaca
ctcaagttcgttacgcacggtccatattccacgaacattggttctcgtgtctacttgatg
gattcctccgactccaaataccagcaattcaacttacttaaccaagaatttacgttcgac
gttgacatgtcgaatttgccttgcggtctcaacggtgctctctacttcgtgtccatggct
gccgatggtggtgtcgctggaaataacaaggccggtgcgaaatatggtactggatactgt
gatactcagtgccctcacgacatcaagttcatcaacggcgaggccaacgtagcaggctgg
gagccatcccccaatgacgaaaacgccggaaagggacaatatggtgcttgctgcaatgag
atggatatctgggaagccaacaacaatgctgctgcttacactccacacgtttgccgtaac
accaacggtggacagactcgttgctcaggaaatgactgtggtgatggcgataacagatat
ggcggtatttgcgataaggatggttgtgacttcaactccttccgtatgggagacaagaac
ttcctcggtccgggcaagactgtcaacaccaactccaagttcaccgtcgttactcagttt
atcaccagtaacaactctacgtccggaacccttaaggagatccgtcgtctctacgttcaa
aacggaaaagttatccagaactcgaagaccagcatctctggcatgagcgcctacgattca
atcaccgaccagttctgcgcggatcagaagaaggctttcggtgacactccctcctttgct
gacaggggtggtttgactgctatgggtaacgcctttgccaagggtatgactcttgtcatg
agtctttgggacgaccacgaggccgagatgttgtggctcgactccaactaccctctcgac
aaggatgcttctactccaggtgttgcaagaggcacatgctcatcagacagcggcgaccct
aagacagtggaatcgcagcacccagatgcgactgtcatctactccaacattaaatacggc
cccattggatcgacttatagtcactaa

DBGET integrated database retrieval system