KEGG   Moniliophthora roreri: Moror_63Help
Entry
Moror_63          CDS       T03137                                 

Definition
(GenBank) dihydrolipoamide s-acetyltransferase (e2 component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00010  Glycolysis / Gluconeogenesis
mrr00020  Citrate cycle (TCA cycle)
mrr00620  Pyruvate metabolism
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
mrr01130  Biosynthesis of antibiotics
mrr01200  Carbon metabolism
Module
mrr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moror_63
   00020 Citrate cycle (TCA cycle)
    Moror_63
   00620 Pyruvate metabolism
    Moror_63
Enzymes [BR:mrr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Moror_63
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ESK98313
UniProt: V2XGI8
AA seq 451 aa AA seqDB search
MASVAARIFARRFHVSARRHALSQFNMPAMSPTMTEGGIAAWKKKEGESFSAGDVLLEIE
TDKATIDVEAQDDGVMAKIIVPEGTKNVKIGQPIAIVGEEGDDLSGAAEMASKASSEAPK
EEKKEEKAAPAPKAEPETPKSSPSQEFKEDSKPDLPIGDRIFASPIAKKIALERGIPLSK
VKGSGPNGRILREDVEKYKPAIEAATSTASQPAAAQLPDYVDTTISNMRSTIGSRLSQSK
QELPHYYVTVDINMDKVLKLREVFNKTLGEKDPSAKLSVNDFIVKAVACALSDVPEANSA
WLGDVIRTYKKADISVAVATPTGLITPIVKDVGAKGLATISAETKALAKKARDGKLAPSE
YQGGTFTISNLGMYGVSHFTAIINPPQSCILAVGSTEPKVVPAPEEERGFKFVQSMKVTL
SSDHRTVDGAVAARWLSAFKGYMENPLTFML
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgtcgctgctcgtattttcgcgcgtcgcttccatgtctccgcgcgcaggcat
gcactctcccaatttaacatgcccgctatgagtcctacgatgacggagggtggcattgct
gcctggaaaaagaaggagggcgaaagcttctctgcaggagatgtccttttggagattgaa
accgacaaggcaaccattgacgtcgaagctcaggacgacggtgtaatggcaaaaattatt
gtaccagagggtacaaaaaacgtgaaaattggccaacctattgctatcgtcggagaggag
ggcgacgacctctctggcgctgctgaaatggcttccaaggcatcttcagaagcacctaag
gaggagaagaaggaggagaaggcagcaccagcccccaaggcagagcctgaaactcccaag
tcatcaccctcacaggaattcaaggaagactctaagcctgaccttcctattggcgaccgt
attttcgcgtcacctatagccaagaaaattgctttggaacgtggcatccctctcagtaag
gtcaagggctcaggtcctaatggccgaattctccgcgaagacgtcgagaagtacaagcct
gctatcgaagctgctacctctaccgcatcacaacccgcagctgctcaattacctgactat
gtcgataccaccatctccaacatgcgtagcaccattggctctcgtctctcgcagtcgaaa
caagaactccctcactactacgtcactgtcgacatcaacatggacaaggttttgaaactt
cgcgaggtcttcaacaaaactctgggtgagaaggaccccagcgctaagctcagcgtgaac
gacttcattgtgaaagctgttgcatgcgcattgtcagatgtgccagaggcaaactcggca
tggttaggcgatgttattcggacttacaagaaggcagatatttctgtcgctgttgccacc
cctactggtctcatcacgccgatagtgaaagacgttggtgccaaaggcttggccacaata
tccgcagagaccaaggctctcgctaagaaggcacgcgacggcaaacttgcaccttccgag
taccagggtggaactttcaccatctccaacctggggatgtacggcgtctctcacttcacc
gccatcataaaccctccccaatcatgtatccttgccgttggctctacggagcccaaagtc
gttcctgcgccggaagaggagcgtggcttcaaattcgtccagtccatgaaggtcacactc
agctctgaccaccggacagtggatggcgcagtcgctgctagatggttgtcggcattcaag
ggttacatggagaacccactgacgttcatgctctaa

DBGET integrated database retrieval system