KEGG   Moniliophthora roreri: Moror_8257Help
Entry
Moror_8257        CDS       T03137                                 

Definition
(GenBank) extracellular invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00052  Galactose metabolism
mrr00500  Starch and sucrose metabolism
mrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Moror_8257
   00500 Starch and sucrose metabolism
    Moror_8257
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Moror_8257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-ProteinID: ESK94272
UniProt: V2XKM1
AA seq 638 aa AA seqDB search
MKPALVGLALLTYVSAEVSKRQVDYNAAPPNISTLPNGALFSTWRPKAHVLPPSGHIGDP
TGHYVDPNTGLFHVGYLYTSFANESIRGGGAAATTSDFVTYQDIHSTDSRFIKPGGINDP
LAVFDGTVIASGYQGNPTFIYTAVSFLPISWTLPYIPGSEAQAIAVSNDTGRNFNKLERG
PVVASAPFGLNVTGWRDPFSFQDPEFDRLLNSTKDSWYLLISGGEHEVGPALFLYRKYDV
DFMEWEYLGRFWRESVNTTWGKGIWAGRWGYNFEVGNVFRIGADGIDPNGTLFSLVGTEG
GKYGIQGGRAQLWAAGDLEQPTNETVSFNVTMAGILEWGSAAYAASGKVVPANSKPSQAS
GAPDRYIVWLWLTGTFYDSIPFPVKPQGWDSSLLTPRELYVETIQNVVDNAAVHETGSWK
VSKTDSASGTVELVTLGIKPAREAIAAYTGQSSTVYKEADRTLNGTASNATVVPFTEAAP
RSRYYVLKASLTFPQVARNASDFRAGFQILSSEFEKTTIYYQFSNESLIVDRSNSSAVAL
TTRGIDSRNEAGRLRLWDIKDTNGGVKVESLDLQIIVDNSIVEIYANNRFTLSTLVLPWY
NSSKGISFFGEGEGVVSFRNVTVYEGLVDAWPDRVHQL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgctcttgttggcctggccttgctaacttacgtatctgcagaggtttcgaaa
aggcaggttgactacaatgctgcacctcccaacatctcaacgttacccaacggcgccttg
ttcagtacgtggagaccgaaagcacacgtactcccgccctccggtcacataggagaccct
acaggccattatgttgatcccaacactggactcttccacgtcggatacctttataccagt
ttcgccaacgaaagtattcgtggaggaggagcagccgcaacaactagcgattttgtcacg
taccaggacattcactctaccgattctcgcttcatcaaacctggaggcatcaatgatcct
cttgccgtgtttgacggaacagtaattgcgtccggatatcaagggaatcccacctttatc
tacactgctgtgtcgttcttgcctatcagctggaccttaccgtatattccaggaagcgag
gctcaggcaattgcggtttcaaatgacactggccgtaacttcaacaagctggaaagaggg
ccggttgttgcttcggcaccctttggtttgaacgttactggttggagagatccgttctct
ttccaagacccggaatttgacaggttactgaacagtacgaaggatagttggtacttactc
atttctggtggtgaacacgaagtgggtcctgctctattcctctaccggaagtatgatgta
gatttcatggaatgggaatatctcggtcggttctggcgggagtcagtaaacaccacttgg
ggcaagggcatctgggcgggtcgctggggatataacttcgaggtcggaaacgtcttccgg
attggagccgatggtatcgatcctaatggaactctgttcagtctggttggcacagagggt
gggaagtatgggattcaaggaggcagagctcaactttgggcagctggtgatttggagcaa
ccgactaatgaaaccgtttcgttcaatgttacgatggccggcatattggaatggggatcg
gctgcctacgctgcctctggcaaagttgttcctgccaactctaagccttcccaagcaagc
ggcgcaccagatcggtacattgtatggctctggctcaccggtaccttctacgactcgatt
cctttccccgtcaagccgcagggctgggacagctcattgttgaccccgcgtgagctttac
gtcgaaaccatccagaacgttgtcgacaacgccgctgtccacgagaccggctcgtggaaa
gttagcaagaccgattcagcctccggtactgtcgagcttgttactctcggtatcaaaccc
gctcgagaagccattgctgcatacaccggtcaatccagtacggtatacaaagaagctgac
agaacactcaatggaactgcttccaacgccaccgtagtgccgttcacagaagcagcgccc
aggtcccgttactatgtccttaaggcatctttgactttccctcaagtagcgcggaatgct
tccgacttccgtgcaggtttccagatcttgagttcagagtttgagaagactactatctac
taccagttcagcaacgaatctctcatcgtcgaccgaagtaattcgagtgctgttgccctg
actacacgaggcatcgactcgcgcaacgaagccggacgattgcgcttgtgggacatcaag
gataccaacggcggtgtaaaggttgaatcacttgaccttcaaatcattgtcgacaactcg
attgtggaaatatacgcgaacaataggttcacattgagtaccctcgttctaccttggtac
aattcctccaagggaatctcgttcttcggcgagggtgaaggtgttgtctcgttccgcaac
gtgactgtctatgagggtctggtggatgcttggcctgatagagtacatcagttgtag

DBGET integrated database retrieval system