KEGG   Moniliophthora roreri: Moror_8916Help
Entry
Moror_8916        CDS       T03137                                 

Definition
(GenBank) heat shock protein sks2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mrr  Moniliophthora roreri
Pathway
mrr03040  Spliceosome
mrr04141  Protein processing in endoplasmic reticulum
mrr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Moror_8916
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Moror_8916
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Moror_8916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mrr01009]
    Moror_8916
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mrr03041]
    Moror_8916
   03009 Ribosome biogenesis [BR:mrr03009]
    Moror_8916
   03110 Chaperones and folding catalysts [BR:mrr03110]
    Moror_8916
   04131 Membrane trafficking [BR:mrr04131]
    Moror_8916
   03051 Proteasome [BR:mrr03051]
    Moror_8916
   03029 Mitochondrial biogenesis [BR:mrr03029]
    Moror_8916
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrr04147]
    Moror_8916
Protein phosphatases and associated proteins [BR:mrr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Moror_8916
Spliceosome [BR:mrr03041]
 Complex B
  Other components
   Prp19 complex
    Moror_8916
 Complex C
   Prp19-CDC5 complex
    Moror_8916
Ribosome biogenesis [BR:mrr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Moror_8916
Chaperones and folding catalysts [BR:mrr03110]
 Heat shock proteins
  HSP70 / DNAK
   Moror_8916
Membrane trafficking [BR:mrr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Moror_8916
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Moror_8916
Proteasome [BR:mrr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Moror_8916
Mitochondrial biogenesis [BR:mrr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Moror_8916
Exosome [BR:mrr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Moror_8916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR StbA
Motif
Other DBs
NCBI-ProteinID: ESK93013
UniProt: V2X1J9
AA seq 614 aa AA seqDB search
MSAEDMFEGAVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFSAEERLIGDAAK
NQAAMNPRNTVFDAKRLIGRRFDDPDVKKDMSHWPFEVVEKDGSPLIKVNYLGEDKTFTP
QEISSMVLIKMKEISEAKLGKTVKKAVVTVPAYFNDSQRLATKDAGAIAGLDVLRIINEP
TAAAIAYGLDRQSKAEKNVLIFDLGGGTFDVSLLNISGGVFSVKATAGDTHLGGEDFDNT
LLEHFKNEFKRKSKHDISDDPRALRRLRSACERAKRTLSSVTQTTVEVDSLYQGEDFSAN
ITRARFEEINATLFKSTLEPVEKVLKDAKMPRDKVDDIVLVGGSTRIPKIQSLVSEYFGG
RQLNKSINPDEAVAYGAAVQAAVLTGQTSEQTKDLLLLDVAPLSLGVAMQGDVFGVVVPR
NTPIPTNKSRTFTTVEDNQTTVTFPVYEGERTQCRDNRLLGEFELTGIPPMPRGTAELVT
TFEVDANGLLKVSAMDRASGRKASISITNSVGRLSSAEIEQMIKDAEQFKIADKEFSARH
EAKSDLEAYIHQVEGTITSPEIGMKLKRGAKAQVEAELARALEKLEIEDSTADELKKAQL
GIKRALQKATAGIR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgaagatatgttcgaaggtgctgtcggcatcgatctcggcaccacttactct
tgtgtcggtgtttggcaaaatgatcgtgtcgagatcatcgccaacgaccagggtaaccgg
acaaccccgtcatacgttgctttctctgccgaggagcgtcttatcggtgatgccgcaaag
aaccaggcagcaatgaacccacgcaacaccgtctttgacgcaaaacgcctcatcggtcgc
cgcttcgatgatcccgacgtcaagaaggatatgtctcactggcctttcgaagttgtcgaa
aaggatggctccccgctcattaaagtcaactacctaggagaggacaaaaccttcactccc
caggagatttcttccatggtcttgatcaagatgaaggaaatctctgaggccaagcttggc
aaaactgtcaaaaaggccgttgtcaccgttcctgcctacttcaacgactcccaacgtctt
gcaaccaaagatgctggtgctatcgctggtctcgatgttcttcgtatcatcaacgagccc
actgctgccgctattgcctacggtcttgaccgccaatccaaggctgagaagaacgttctc
attttcgatcttggtggaggaaccttcgatgtttctcttttgaacatcagtggaggtgtc
ttcagcgtcaaggccacagccggtgacactcacttgggtggtgaggacttcgacaacaca
cttttggagcacttcaagaacgagttcaagcgcaaatccaagcacgatatctccgacgat
ccccgtgccctccgacgtctccgaagtgcatgcgagcgtgcaaagaggaccctctccagt
gtcacccagactaccgttgaggttgactccttgtaccagggtgaggacttctcggcaaac
attacccgtgcccgtttcgaggaaatcaacgctactttgttcaaatcgacactggagccc
gtcgagaaggtgctgaaggatgctaagatgcctcgtgacaaggtcgacgacatcgtcctt
gtcggtggttcaacccgtatccccaagattcagtccctcgtgtctgagtacttcggcggt
cgtcaattgaacaagtccatcaaccccgacgaagctgtcgcgtacggtgctgctgtccag
gccgctgtccttactggtcaaacttccgagcagaccaaggacctcctccttctcgatgtt
gctcccctttcccttggtgtcgccatgcagggtgatgtcttcggtgtcgtcgttccccgt
aacactcctatccccaccaataagtcgagaacattcaccactgtcgaggacaaccaaact
actgtcactttccctgtgtacgagggcgagcgtacacaatgccgcgacaatcgtctcctg
ggagagttcgagcttactggtatacctcctatgcctcgtggcactgctgagcttgtcact
accttcgaggtcgacgccaacggtcttctcaaggtctctgccatggatcgtgcctccggc
cgcaaggcttctatcagcatcactaactctgtcggtcgtctctcgtcggctgagattgag
caaatgatcaaggatgctgagcagttcaagatagctgataaggagttctctgctcgtcac
gaagccaagtccgacctcgaggcctacattcaccaggtcgagggtaccatcacatcaccg
gagattggtatgaagctcaagcggggagctaaggctcaggttgaggctgagcttgctcgt
gctctcgagaagttggagatcgaggactcgacagcagacgaactcaagaaggctcaattg
ggtatcaagcgagcgttgcagaaggcaactgctgggattcggtaa

DBGET integrated database retrieval system