KEGG   Moniliophthora roreri: Moror_9521Help
Entry
Moror_9521        CDS       T03137                                 

Definition
(GenBank) atp-dependent rna helicase dhx8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mrr  Moniliophthora roreri
Pathway
mrr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Moror_9521
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mrr03041]
    Moror_9521
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Moror_9521
Spliceosome [BR:mrr03041]
 Complex C
  Other components
   Step II factors
    Moror_9521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1
Motif
Other DBs
NCBI-ProteinID: ESK80691
UniProt: V2WJJ0
AA seq 362 aa AA seqDB search
MQESESYIGVNDKVLAEFVIDLHGQSNKSLSELQAFGADFPDSFVENVDRLILSLHPKHK
KKLATNGEVAAKGDGELTEEERKRQMFPGLALKDQEVEPKRPSELERSPKRQRTERSPPR
RRSPSPPRGGRGHDDRRGRSSRPALDDSPILFKIYNGRISGLKEFGAFVQLEGVAGRVEG
MVHVSNIQTGTRVNSASDLLSKGQNVKVKVISVAGNRIGLFMKDVDQVSGRDLTPHPRIK
SEAEMEEEQRHAARASMSGANAVLLNSKDEGPKRSAKRLTSPEQYPDLMHNFMVRAEVEV
EIREGEPPFLAGQTKRTLDLNPVKIVKAPDGSQPSGTGWSRSVESCDSRKQTNKQIRKLE
IS
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagcgaaagttacattggcgttaatgacaaagttcttgccgagttcgttatc
gaccttcatggccagtccaataaaagcctctccgagctacaggcattcggtgccgacttt
ccagactctttcgtagagaatgtagatcgtctcattctcagcttgcatccaaagcacaaa
aaaaagttggctaccaatggggaggtcgcggctaaaggagatggagagttgactgaggaa
gagaggaagaggcagatgttccctggtttggctttgaaggatcaagaggtcgaaccaaaa
aggccgtcggaattggagcgctcaccgaaacgacaacggacggaaaggtcgcctccaagg
cgaaggagtcctagtccgcctcgtggagggagaggtcacgatgatcgtagagggaggagc
agtcgtccagctctagatgatagtccgattttattcaagatatataatggtcgaatatct
gggctaaaagaatttggagcatttgtgcagctagagggtgttgctggaagggttgaagga
atggttcatgtctcgaatatccagacgggcacacgcgtgaattcggcatcagaccttctg
agcaaaggccagaatgtcaaggtaaaggtcataagtgtcgctgggaacaggataggtctt
ttcatgaaagacgtggatcaagtcagcggtcgagatttgacgccacacccacgaataaag
tcagaagcagagatggaggaggaacaacgacatgctgctcgtgcttcaatgtcaggcgcg
aacgcagttctgttgaactcgaaggatgaaggtcctaagcgctctgcgaaacgcctcacc
tctccggagcaataccctgacctcatgcacaacttcatggtccgagccgaggtcgaagtt
gagatccgagagggcgagccaccgttcctggctggccaaacgaaacgaaccctcgatttg
aatccggtcaagattgtcaaagcaccggacggttctcaaccgagcggcactggctggtca
aggagcgtagagagttgcgacagcaggaagcaaacgaataagcagattcggaagctcgag
atttca

DBGET integrated database retrieval system