KEGG   Muricauda ruestringensis: Murru_0473Help
Entry
Murru_0473        CDS       T01598                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00790  Folate biosynthesis
mrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Murru_0473
Enzymes [BR:mrs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Murru_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEM69527
UniProt: G2PSQ0
Position
476573..477406
Genome map
AA seq 277 aa AA seqDB search
MTINCKGELVDLKRPKVMGILNLTPDSFFDGGKYKDEGSILKQVEFMLDHGASFIDMGAY
SSRPGAEHVPEDEELRRMIPVIELILKRFPDTLISVDTFRSKVAAESIEHGAAIINDIAA
GNLDDEMFGTIAKYQVPYIMMHMKGTPQSMQKEAAYNNLINDLRLYFSEKVQKATSQKIN
DIIIDPGFGFAKTTEQNYTLLNHLDMFQTFGLPILIGLSRKSMIYKVLKSSPQEALNGTT
TLHTIALLRGANIIRAHDVKEATECVKLVEALKENAL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccataaactgcaaaggtgaacttgtagacctaaaaaggcccaaagtaatgggcatc
ctcaaccttactccagattctttttttgatggtggaaagtacaaggatgagggttccata
ctcaagcaagtggaatttatgctcgaccatggtgcctcttttattgatatgggcgcctat
agttcccgacctggtgccgaacatgttccagaggatgaggaattgcgcagaatgattcct
gttatcgaacttatcctgaaaaggtttccggacaccttaatttctgtagatacattcaga
agtaaagtggctgcagaaagtattgagcatggtgctgccattattaacgacattgccgcg
ggaaatttggatgatgaaatgtttggaaccattgctaaataccaagttccgtatattatg
atgcacatgaaaggcaccccacaatccatgcaaaaagaagctgcctacaataacttaata
aatgacctcaggctttatttttcagaaaaagtccagaaggccacctcccaaaaaataaat
gatattattatagacccaggttttggctttgccaaaacaacggaacaaaattatacgctt
ttaaaccatttggatatgttccaaacctttggtttgcctattttgatcgggctgagcaga
aaatcaatgatctacaaagttttgaaatcatctccacaagaggcattgaacggtactacg
accctacacaccatcgcccttttaaggggtgcaaatattattcgggcccacgatgtaaaa
gaagctacagaatgtgttaaacttgtggaagccttaaaagagaacgcgctctga

DBGET integrated database retrieval system