KEGG   Muricauda ruestringensis: Murru_0505Help
Entry
Murru_0505        CDS       T01598                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00250  Alanine, aspartate and glutamate metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Murru_0505
Enzymes [BR:mrs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Murru_0505
Peptidases [BR:mrs01002]
 Cysteine Peptidases
  Family C44
   Murru_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans OB_RNB
Motif
Other DBs
NCBI-ProteinID: AEM69559
UniProt: G2PST2
Position
complement(513483..515153)
Genome map
AA seq 556 aa AA seqDB search
MCGIVCAFDVKESTEALRPQLLEMSKKVRHRGPDWSGIYSDDKAILAHERLAIVDPASGK
QPLLSADGKLVLAANGEIYNHQELRKQFDGKYDFKTQSDCEVILALYQEKGPDFVDEMNG
IFGFAIYDSEKDEYFIARDHMGIIPLYIGWDKNGTFYVASELKALEGTCSKIQLFPPGHY
MHSSDGEFVKWYKRDWMEYDAVKENETSIVKIKDALEAAVHRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYSQKRIESGDTADAWWPQLHSFSVGLEGSPDLAAAQKVADHIGTVHHEIKF
TIQEGLDAIKDVAYNLETYDITTIRASTPMYLMARVIKSMGIKMVLSGEGADELFGGYLY
FHKAPSPKDFHEETVRKLDKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMSINPKD
KMINGERMEKWVVRKAFEDYLPESVAWRQKEQFSDGVGYSWIDTLKALVEEEITDEQLEN
AHFKFPIQTPTSKEEYYYRSIFESHFPSDAAALSVPQEPSVACSTKIALEWDEAFKNMND
PSGRAVAKVHTDAYVK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtttgcgcatttgatgtaaaagaaagtacagaagcattaaggccccaa
ttgttggagatgtcgaagaaagtaaggcaccgtgggccagattggagtggtatctactcc
gatgacaaagctattttggcccatgagaggttggccattgtagatcctgcttcgggaaag
caaccattgttgagtgcggacgggaaattggttctggccgccaatggtgaaatatacaat
catcaagagttaagaaaacagtttgatgggaaatacgatttcaagacccaatccgactgt
gaagttattttggcactttaccaagaaaagggccctgattttgtggatgaaatgaacgga
atctttggttttgccatttatgattcagaaaaagatgaatatttcattgctcgtgaccac
atgggcatcattccattgtacattggttgggataaaaacggaactttttatgtggcttcg
gaactgaaagctttggaagggacttgttcaaaaattcaattgtttcctcccggacactac
atgcacagctccgatggggagtttgtaaaatggtacaagcgggactggatggagtatgat
gccgttaaggagaacgaaaccagtatagtaaaaatcaaagatgctttggaagcagccgtg
caccgtcagttaatgtccgatgtgccttacggtgtgttgttatccggaggattggattct
tccgtaacatcggccattgcaaaaaaatattctcaaaaaagaatagagtccggtgatacc
gccgacgcttggtggccacagttgcactctttctccgtaggattggagggttcacctgac
ttggcagccgctcaaaaggtagcggatcatatcggcaccgtgcaccacgaaataaaattt
accattcaagaagggttggatgcgataaaagatgttgcatataatttagaaacttacgat
attacaaccataagagcttcaactccaatgtatttaatggcaagggtgattaaatccatg
ggaataaagatggtgctttccggtgaaggggcagatgaactttttggaggatacctgtat
tttcacaaggcaccaagcccaaaggattttcatgaggagaccgtaagaaagctggataaa
ctccacatgtacgattgccttagggccaataaatcgttggcagcatggggtatagaagga
cgagtaccttttttggacaaggaatttatggatgtagcaatgagcattaacccaaaagat
aaaatgatcaacggagagcgtatggagaaatgggtggtgcgcaaagcttttgaggattat
ctgcccgaaagtgtagcttggagacagaaagaacaattttcagatggtgttggatacagc
tggatagatactttgaaagctttggtagaagaagagattaccgatgagcagttggaaaat
gcccatttcaagttccctatccaaacaccgacatcgaaagaagaatattattatcgttcc
atttttgaaagtcatttcccgtcagatgcagcagcattgagcgttccgcaagaaccttca
gtagcctgtagtaccaagattgccttggagtgggacgaggcgttcaagaacatgaacgac
ccatcgggaagagccgtggctaaggttcataccgatgcgtatgtgaaataa

DBGET integrated database retrieval system