KEGG   Muricauda ruestringensis: Murru_1329Help
Entry
Murru_1329        CDS       T01598                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00860  Porphyrin and chlorophyll metabolism
mrs00970  Aminoacyl-tRNA biosynthesis
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
Module
mrs_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
mrs_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mrs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Murru_1329
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Murru_1329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mrs01007]
    Murru_1329
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrs03016]
    Murru_1329
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mrs02048]
    Murru_1329
Enzymes [BR:mrs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Murru_1329
Amino acid related enzymes [BR:mrs01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Murru_1329
Transfer RNA biogenesis [BR:mrs03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Murru_1329
 Prokaryotic Type
   Other AARSs
    Murru_1329
Prokaryotic defense system [BR:mrs02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Murru_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AEM70371
UniProt: G2PPB9
Position
complement(1456453..1457949)
Genome map
AA seq 498 aa AA seqDB search
MSQNVRVRFAPSPTGPLHIGGLRTALFNYLFAKKHGGDFVLRIEDTDQNRFVEGAEEYII
EALNWCGIPFDEGPGKEGDFGPYRQSERKDLYKAYALELIEKGKAYYAFDTAETLDHHRK
DHEAKGKTFIYNWHNRLKLTNSLSLSEEEVKAKLEAGEDYVIRFKSPENEALFLNDIIRG
EIKIDTSILDDKVLFKSDGMPTYHLANIVDDHLMQITHVIRGEEWLPSLALHTLLYDALG
WEAPKFAHLPLIMKPVGKGKLSKRDGEKGGFPVFPLTWNQSEGYREAGFFPEAVINFLAL
LGWNPGTEQEIFSLEELVDSFTLERVNKSGARFDPEKNNWYNQQWLQRKSDEELAEQFAA
ELAKKQISSEQGYVQKVVSLIKERASFVKDFWELGDYFFEAPSSYNEKAVKKQWKEGSPE
IMEQVASVLNSVQDFESPTIEEKVKGWISDNELSFGKVMPPLRLIIVGDMKGPHLFDIME
LIGKEESINRIKTAIAQL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaacgtacgtgttcgatttgcgccaagcccaaccgggccattacatattggt
ggtctgcgcaccgccctgttcaattatttattcgccaaaaaacatggcggcgattttgta
cttcgtattgaagatacggaccaaaaccgatttgttgaaggcgcagaggaatatattatc
gaggccttgaactggtgtggaattccctttgatgaaggtccgggcaaagagggtgatttt
ggcccatatcgacaaagtgagcgcaaggacctgtacaaagcctacgctttggaacttatt
gaaaaaggcaaggcctattacgcttttgatactgctgaaactttggaccaccatagaaaa
gatcatgaggcgaaaggaaaaacatttatatacaattggcacaaccgtttaaaattgaca
aactcactttctctttcggaagaagaagtgaaagctaaattggaggctggtgaggattat
gtaatccgatttaaatctccagagaatgaagcgttgtttttgaacgacatcatccgaggt
gaaattaaaattgacaccagcattttagatgataaggttttgtttaaaagcgatggcatg
ccaacctaccatttggccaacattgtggatgaccacttaatgcaaattacccatgtaatt
cgtggagaagaatggttgccgtccttggcccttcatacgcttttgtacgatgcccttgga
tgggaggctccaaaatttgcgcacctgcccttgatcatgaaaccagttggaaaaggaaaa
ttgagcaagcgtgatggcgaaaaaggcggcttccccgtatttccgctcacgtggaaccaa
tcggaaggataccgcgaggcaggttttttcccagaagcggtaatcaacttcttggccttg
ttgggctggaaccccgggactgaacaagaaatttttagcttggaggaattggtcgattcc
tttaccttggagcgtgtgaacaaatcgggggcacggttcgatccagaaaaaaacaattgg
tataatcaacagtggttacagaggaagtctgatgaagaacttgccgaacagttcgccgct
gagctggccaaaaaacaaatttcatcagaacagggttacgttcaaaaagtagtatccttg
attaaggagcgcgcaagttttgtaaaggacttttgggaattgggagactatttttttgaa
gcaccatcttcttacaacgagaaagctgtcaaaaaacaatggaaagaaggttctccggaa
atcatggaacaggtggcatcggtactgaatagcgttcaagattttgaatcgcccacaata
gaagaaaaagtgaaagggtggatatccgacaatgagctttcctttggaaaagtgatgcct
cccctccgcttgatcatcgttggcgacatgaaaggcccgcatttgttcgatataatggag
cttattggcaaagaggaaagtataaaccgtattaaaacagcgattgcccaactctag

DBGET integrated database retrieval system