KEGG   Muricauda ruestringensis: Murru_2997Help
Entry
Murru_2997        CDS       T01598                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00260  Glycine, serine and threonine metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
mrs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2997
Enzymes [BR:mrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Murru_2997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEM72019
UniProt: G2PK34
Position
3304797..3305822
Genome map
AA seq 341 aa AA seqDB search
MEINLISDTVTRPSAGMLEAMMNAKVGDDVFKNDPTVNELESKIATYFGVEAALFFPSGT
MTNQTAIKIHTQPGDQLICDKYAHVYNYEGGGVSFNSGVSCKLVDGNRGMMTAEQVEASI
NPPDFYHSPLTSLVCIENTTNKGGGACWDFEELKKIRKVCDEHNLKYHLDGARLWNALVK
KGEDPKAYGQLFDSISVCLSKGMGCPVGSVLLGSKNDIDKALRIRKIFGGGMRQSGYLAA
AGIYALENNVKRLAEDHKKAQEIGKVLQSLDFIKKVEPIETNIIIFEINENKISSEAFLE
QLTKNQVSIIGMGQGKLRIVTHLDYTDAMHQHFLKVLKSIG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggagataaacttaataagtgacactgtcacaagaccttcggctggaatgttggaggcc
atgatgaatgctaaagtaggggacgatgtttttaagaacgaccctacggtaaacgaattg
gaatccaaaattgctacgtattttggcgtggaagctgccctatttttccctagtggcacc
atgaccaatcaaacagctataaaaatccacacccagcctggcgaccagttgatctgtgat
aaatatgcgcacgtctacaattacgaagggggaggagtaagttttaatagtggggtttcc
tgtaaattggtggatggcaatagaggtatgatgaccgcagaacaggtcgaagcatcaatt
aatccaccagatttttaccacagtccattaacctctttggtctgcatagagaacaccacg
aacaaaggaggtggagcctgttgggattttgaagagttgaaaaaaatccgaaaagtctgt
gatgagcacaatctaaaatatcatttggacggtgcccgactttggaacgctttggtaaaa
aaaggcgaggacccaaaagcctacggacagttatttgacagcatcagcgtatgtttaagc
aaaggtatgggctgccctgtgggttctgtgcttttgggtagtaaaaatgatattgataaa
gccttgcgaatccgtaaaatttttggaggtggcatgcgtcagtccggttatttggccgca
gcagggatttatgccttggaaaacaacgtgaaacgattggcagaagaccacaagaaagct
caagaaatagggaaggtgcttcaatccttggatttcattaaaaaagtggaacccatcgag
accaacatcatcatttttgaaataaatgagaacaaaatatcatctgaggcatttttagag
caattgaccaaaaatcaggtatccatcatagggatggggcagggaaaattgcgcattgtt
acccatttggactataccgatgcgatgcatcagcatttcttaaaagttttgaaaagtatt
ggataa

DBGET integrated database retrieval system