KEGG   Malassezia restricta: MRET_1717
Entry
MRET_1717         CDS       T06113                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mrt  Malassezia restricta
Pathway
mrt00100  Steroid biosynthesis
mrt01100  Metabolic pathways
mrt01110  Biosynthesis of secondary metabolites
Module
mrt_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MRET_1717
Enzymes [BR:mrt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MRET_1717
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT
Other DBs
NCBI-GeneID: 38738483
NCBI-ProteinID: XP_027484519
Position
III:complement(join(179111..179152,179195..179207,179272..179500,179529..180552))
AA seq 435 aa
MSNKKDSAQADVLAPRSRELEFGGVLGALFITVTVPLTMYYLTFGCSPEMGCSLPLSASN
AQALWTYARQQLVASFQDRMGWNLYYAWYMYCVVAWFVVDGKWVEGLPLRTGEKLRYKIN
ALKTGAIALGFAMTIIFIKGPASFTLLYDHFPGLLSAALVNSILQAVYVYAASFHGKKLL
ALGGNSGNPIFDWFIGRELNPRIGEFDIKTFNELRPGLILWALLDISCVCHQYTKFGWVS
DSIVLVTLFHIWYIADSLINESTILTQMDITTDGFGFMLSVGDLAWLPFTYCLQARFLAF
HPIHLGWLGVLAILAVQFTGYYIFRVANLEKNEFRHGRNPKGLQYMTTSSGRKLLTSGWW
GRSRHPNYLGDWIMGWAWCLPCGFSTPIPYFYVIYFAVLLWHRQLRDDDACRKKYGADWD
VYCRRVPYRIIPYVY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtcgaacaaaaaggacagtgcacaggcggatgtccttgcgccgcgctccagggagctc
gagttcggaggggtactgggtgcattgttcattacggtgactgtgccgctcaccatgtac
tatctcacgtttggatgcagtcccgagatgggatgctcgttgcccctatctgcttcgaac
gctcaggccttgtggacctatgcccgtcagcagcttgtggccagtttccaagaccgcatg
ggatggaacctgtattatgcatggtacatgtactgtgtcgttgcatggtttgtggttgat
ggtaaatgggtcgagggcctgcctctccgcacaggggaaaagctccggtacaagatcaat
gcgctcaagacgggcgccattgctttgggatttgccatgacgatcatattcatcaagggt
ccggcatctttcacgctcttgtatgatcacttccctggactgctcagtgctgccttggtg
aactcgattctgcaggccgtctatgtgtacgctgcatcgtttcatggtaaaaagctcttg
gccctgggaggcaacagcggcaatcccatctttgactggttcatcggccgcgagctgaat
cctcgtatcggtgaatttgacatcaagaccttcaacgagctgcgtccgggtctcatcctt
tgggcgctactggacataagctgtgtgtgccaccaatacaccaagtttggttgggtcagt
gacagcattgttcttgtgacactgttccacatttggtatattgccgattcgctcatcaat
gaatcgactattctcacacaaatggacattacgacagatggcttcgggttcatgctcagt
gttggcgaccttgcttggctaccattcacgtactgcttacaagcgcgcttcctggctttc
catccgatccatctcggctggcttggtgtgctagcgattctcgctgttcagttcacaggc
tattacatcttccgcgtggcgaaccttgagaagaatgagttccgtcatggacgtaatccc
aaaggactgcaatacatgacgacgtctagcggacgtaaactactcacttcaggatggtgg
ggcagaagtcgtcaccccaactacctcggcgactggattatgggctgggcgtggtgtttg
ccgtgtggctttagcacaccgatcccctacttttacgtcatctacttcgccgtgctgctt
tggcaccgtcagttgcgcgatgatgatgcatgccgcaagaagtatggagcagactgggac
gtttactgccgacgtgttccataccgcatcatcccatacgtatactaa

DBGET integrated database retrieval system