KEGG   Malassezia restricta: MRET_2131Help
Entry
MRET_2131         CDS       T06113                                 

Definition
(RefSeq) NADH dehydrogenase (ubiquinone) Fe-S protein 3
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
mrt  Malassezia restricta
Pathway
mrt00190  Oxidative phosphorylation
mrt01100  Metabolic pathways
Module
mrt_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MRET_2131
Enzymes [BR:mrt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     MRET_2131
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     MRET_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 38738897
NCBI-ProteinID: XP_027484107
Position
III:complement(820648..821487)
Genome map
AA seq 279 aa AA seqDB search
MSATAARTLLRCARPARLPSMHQSVLVSARALSTTFKVSEQGDKVMLETPYVERANLNPM
VKYESMQGPLHDYGSWVISALPRFIQQFSVYKDELTFYVAPSGLIPTMTFLRDHTNTQFK
ALMDISGADYPSRSQRFEVNYHLLSLRHNARIRVKTYADEVTPVPTVTSLFRSADWFERE
AWDMYGIFFAGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRWDEEKKRVVYEPVQLMQA
HRNFEAASSWEQVGQGVSYTPNEHKLVPPKPAEDNKDKK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgctgctcgaactctcttgcgctgtgcacggcccgcccggctgccttcc
atgcaccagtcagtgcttgtatctgcgcgtgctctctcgacgacctttaaggtgagcgag
cagggtgacaaggtgatgctcgagacgccgtacgttgagcgggcgaacctgaaccccatg
gtaaaatacgaatcgatgcagggtcccttgcacgactacggaagctgggtcatctctgct
cttcctcgcttcattcagcaattcagcgtgtacaaggacgagctgacattttacgtcgct
ccatcgggactcatcccgaccatgacattcttgcgtgaccacaccaacacgcaattcaag
gcacttatggacatctccggcgccgactacccttcgcgctctcagcgcttcgaggtgaac
tatcatctgctgagtctccgtcacaacgcacgcattcgtgtcaagacgtatgccgacgaa
gtgacgcccgtgccgaccgtgacgagcctcttccgcagtgccgactggttcgagcgtgag
gcgtgggacatgtacggcatcttctttgcgggacacccagatctgcgccgcattctgacg
gactacggtttcgagggtcacccattgcgcaaggacttccctctgacaggctatacggaa
gtgcgttgggacgaagaaaagaagcgcgtagtatatgagcccgtccagcttatgcaggct
caccgcaacttcgaagctgcctcatcttgggagcaggtgggacagggtgtttcgtacacg
cccaacgagcacaagctcgtgccaccgaagcctgcagaggacaacaaggacaagaagtag

DBGET integrated database retrieval system