KEGG   Malassezia restricta: MRET_2478Help
Entry
MRET_2478         CDS       T06113                                 

Definition
(RefSeq) heat shock 70kDa protein 1/2/6/8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mrt  Malassezia restricta
Pathway
mrt03040  Spliceosome
mrt04141  Protein processing in endoplasmic reticulum
mrt04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MRET_2478
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MRET_2478
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MRET_2478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mrt01009]
    MRET_2478
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mrt03041]
    MRET_2478
   03009 Ribosome biogenesis [BR:mrt03009]
    MRET_2478
   03110 Chaperones and folding catalysts [BR:mrt03110]
    MRET_2478
   04131 Membrane trafficking [BR:mrt04131]
    MRET_2478
   03051 Proteasome [BR:mrt03051]
    MRET_2478
   03029 Mitochondrial biogenesis [BR:mrt03029]
    MRET_2478
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrt04147]
    MRET_2478
Protein phosphatases and associated proteins [BR:mrt01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MRET_2478
Spliceosome [BR:mrt03041]
 Complex B
  Other components
   Prp19 complex
    MRET_2478
 Complex C
   Prp19-CDC5 complex
    MRET_2478
Ribosome biogenesis [BR:mrt03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MRET_2478
Chaperones and folding catalysts [BR:mrt03110]
 Heat shock proteins
  HSP70 / DNAK
   MRET_2478
Membrane trafficking [BR:mrt04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MRET_2478
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MRET_2478
Proteasome [BR:mrt03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MRET_2478
Mitochondrial biogenesis [BR:mrt03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MRET_2478
Exosome [BR:mrt04147]
 Exosomal proteins
  Proteins found in most exosomes
   MRET_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C StbA DDR Asp_decarbox Zincin_2
Motif
Other DBs
NCBI-GeneID: 38739244
NCBI-ProteinID: XP_027484937
Position
IV:join(187148..187664,187805..189147)
Genome map
AA seq 619 aa AA seqDB search
MSAEVPSTNDSNVYEGAIGIDLGTTYSCVGWWTNERVEIIANDQGNRTTPSYVAFTENER
LIGDAAKNQAAMNPRQTVFDAKRLIGRRFDDPDVKKDMQSWPFTVVDKDGSPVIEVEYLG
EKKQFAPQEISSMVLLKMKEVAEAKIGKEVKKAVVTVPAYFNDSQRLATKDAGAIAGLDV
LRIINEPTAAAIAYGLDSKSSQEKNVLIFDLGGGTFDVSLLNITGGVFAVKATAGDTHLG
GEDFDNTLLEHFKKDFERKNKVDMSNDARALRRLRSACERAKRTLSSVTQTSVEVDSLFQ
GIDFQANITRARFEEINAAAFKGTLEPVAKVLKDSKIPADKVDDIVLVGGSTRIPKIQSL
VSEFFGGRQLNKSINPDEAVAYGAAVQGAVLTNQTSDKTADLLLLDVAPLSLGVAMQGDM
FGVVVPRNTPIPTNKTRVFTTVEDNQTQVTFPVYEGERTQCKDNRLLGEFELTGIPPMPR
GQAELVCTFEVDANGLLKVSAMDKASGRKANITITNSVGRLSSTEIEQMIKDSETFKNAD
KEFQAKHDSRNDLEAYVHSVESTVSNPAATFKRAAKIQIEQELAKAMELLEVEDASADDY
RRASLRLKRSVQKGLSGGR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggaagtgccttctacgaacgactcgaacgtgtacgagggtgccattggtatt
gaccttggtacgacctactcgtgtgttggctggtggaccaacgagcgtgttgagatcatt
gccaacgaccagggtaaccgcacgacgccctcgtacgtcgctttcacggagaacgagcgt
ctgattggtgatgccgccaagaaccaggctgctatgaaccctcgtcagacggtgtttgac
gccaagcgcctgatcggccgtcgctttgacgaccctgacgtgaagaaggacatgcagtcg
tggcccttcacggtggtggacaaggacggcagccctgtcattgaggtcgagtacctcggt
gagaagaagcagtttgccccgcaggagatctcgtcgatggtgctgctgaagatgaaggag
gtggccgaggccaagatcggcaaggaggtgaagaaggccgtcgttacggtgcccgcctac
tttaacgactcgcagcgtctggccacgaaggatgcaggtgcgattgcgggtctggatgtg
ctccgtatcatcaacgagcccacggctgctgccattgcgtacggtctggactcgaagtcg
agccaggagaagaacgtgctcattttcgacctgggtggtggtacgtttgatgtgtcgctg
ctcaacatcaccggtggtgtgtttgccgtcaaggccacggcgggtgacacgcacctgggt
ggtgaggactttgacaacacgctgctcgagcacttcaagaaggactttgagcgcaagaac
aaggtcgacatgtcgaacgatgcccgtgcgctccgccgcctgcgcagcgcctgtgagcgt
gccaagcgtacgctgtcgagtgtgacgcagacgagcgtggaagtggactcgctgttccag
ggcattgacttccaggccaacattacgcgtgcgcgctttgaggagatcaacgccgctgcg
ttcaagggcacgctggagcctgtggccaaggtgctgaaggactccaagatcccggcggac
aaggtcgacgatattgtgctggtcggtggctcgacgcgtatccccaagatccagtcgctt
gtgtcggagttctttggtggtcgtcagctgaacaagtcgatcaaccctgacgaggccgtg
gcctacggtgctgcggtgcagggtgccgtgctcacgaaccagacgagcgacaagacggcc
gacctgctcctgctcgatgtggcgcccctgtcgctcggtgtggccatgcagggcgacatg
tttggtgtggtcgtgccgcgcaacacgccgatcccgacgaacaagacgcgtgtgtttacg
accgtcgaggacaaccagacgcaggtcacgttccctgtgtacgagggtgagcgcacgcag
tgcaaggacaaccgcctgctcggtgagtttgagctcacgggcattccgcccatgccgcgt
ggccaggccgagctcgtgtgcacgtttgaagtggacgcgaacggtctgctgaaggtgtcg
gctatggacaaggcctcgggccgcaaggcgaacatcacgatcacgaactcggtcggccgt
ctcagctcgacggagattgagcagatgatcaaggactcggagacgttcaagaacgccgac
aaggagttccaggcgaagcacgactcgcgcaacgacctcgaggcgtacgtgcactcggtc
gagagcaccgtgtcgaaccccgccgcgacgttcaagcgcgctgccaagatccagattgag
caggagctggccaaggccatggagctcctcgaggtcgaggacgccagtgccgacgactac
cgccgcgcctcgctgcgcctcaagcgctccgtgcaaaagggtctctcgggcggccgctaa

DBGET integrated database retrieval system