KEGG   Malassezia restricta: MRET_3567Help
Entry
MRET_3567         CDS       T06113                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
mrt  Malassezia restricta
Pathway
mrt04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    MRET_3567
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mrt04131]
    MRET_3567
Membrane trafficking [BR:mrt04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    MRET_3567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin Vps39_2 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 38740333
NCBI-ProteinID: XP_027485902
Position
VI:complement(356908..359601)
Genome map
AA seq 897 aa AA seqDB search
MGLDDRSHDEDALSTTSSDTHEPAFHEEHMQASVRDMTVRDSISAMAVSRSHVALGMQSG
MMYIVSLEGHLEKGFRFHTAPILDLVFDATGEFVASAGMDGIAAIASLTTSEQYQFDARR
PLRVIRLEPHFASRSSRAFVCGGMSGVLTYREKRWFGHRDVVLHSDEGPIWALAWRGRWL
AWANDRGVRVAHAQTHEMITLMPTPDDAPRPELARCTLAWRDASTLVVAHGDRITIARIC
EASDSHFVEVTDILQLDCLVAEMACTPQSMFILACVEYDDGVAPELRCVSWQGEELSSDA
LDMQRSRCMNDWHMCMAQEVRYDPLRQHDMRRPVLYVASPRQLSVLRPRDERDHIAWLLA
RRAYRQALEALEALGSAPAAALGYDVAAIGREYLWYLMEERGAYAEAAALMPLLLRTDRG
AWDTFVCCYLERHQVDAILPHIPTQDPQLSEMVYDLVLVHLLQHDPTQLLATLRAWPSHI
YSKQAVAAAIGDHARNSRTLLECLAQLYMAAHQPGKALTYYMRLRDPCVFDLIREYDLLI
DVQHHIGTLVELDQECAGSTEPRSSALMPLLVPYTHSIPIQRAMAQLEPYPWYAYLYLDA
LYERDPSLVTHYAMDLLRLYCRFDYARLMPFLRTMSSAYSLKDAYDVCETYSYVPEMVFL
RGRTGDVVGALQLILERLQHVDMALDFVRQQDDAELWDTLLAYSQDKPAYIRGLLEQASG
EIDPVRIIRPIQDGLEIPGLRPSLIKIFHNFHAQHALLGVGLAVLQRDAYERLAEYDTAC
QAALVCDARTLCTVCLQPLLAAAVPIVLFLCRLHAAHLTCVTSASMPPLPPAVFAPVHET
TTQQYRRTRATTDLTRSPGRIAQERADRRAWLYARQARRLVRGCPACAEAQRDRLAD
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgggactcgatgatcgatcgcacgacgaagatgcgctgagtacgacgtcgtccgatacg
catgagccggcgttccatgaagagcacatgcaggcgagtgtgcgcgacatgacggtgcgc
gactcgatcagtgcgatggccgtgagtcgctcgcatgtggcgctgggcatgcaatcgggc
atgatgtacattgtctcgcttgagggccacctggagaaggggttccgcttccacacggcg
ccgatcctggatctggtgttcgacgcgacgggcgagtttgttgcgagcgccggcatggac
ggcatcgcggcgattgcgtcgctcacgacgtcggagcagtaccagtttgacgcgcggcgt
cccctgcgtgtgatccgcctcgagccgcactttgcgtcgcgctccagccgtgcgttcgtg
tgtggcggcatgtccggcgtcctgacgtaccgcgagaagcggtggttcgggcaccgcgat
gtcgtcctgcacagcgacgagggcccgatctgggcgctcgcgtggcgtggacgctggctg
gcgtgggcaaatgaccgcggtgtgcgtgtcgcgcatgctcagacacacgagatgatcacg
ctgatgccgacgcccgacgacgcgccgcgcccagagctggcccggtgcacgttggcatgg
cgcgatgcgagcacgcttgtcgtggcccacggcgaccgcattacgattgcacggatctgc
gaagcgagtgactcgcactttgtcgaggtgacggacattttgcagctggactgcctcgtc
gcagagatggcatgcacgcctcagtcgatgttcattcttgcgtgtgtcgaatacgacgac
ggcgtcgcgcccgagctgcgctgcgtgagttggcagggcgaggagctgagcagtgatgcg
ctggatatgcagcggagtcggtgcatgaatgactggcacatgtgcatggcgcaagaagtt
cggtatgatcctcttcggcaacacgacatgcgccgccctgtgttgtacgtggcgtcgccg
cggcaactgagcgtgctgcgcccgcgggatgagcgcgaccatattgcctggcttctcgct
cggcgcgcgtaccgccaggcgctcgaggcgctcgaggcgctgggcagtgcaccggcggct
gcgttgggatacgacgtcgctgcgattgggcgtgagtatctttggtacctcatggaggag
cgtggcgcgtatgcggaggccgccgcgctcatgccgctgctgctccggaccgaccgaggc
gcgtgggacacgtttgtgtgctgctacctcgagcggcaccaagtggatgcgatactcccg
cacattccgacgcaggacccccagctgagtgagatggtgtacgatctcgtgctggtgcat
ctgctgcagcacgatcccacgcagctgttggcgacgctccgcgcatggccgagtcacatc
tactcgaagcaggcggtggctgcggcgatcggcgatcacgcacgaaacagccgcacgctg
ctcgagtgcctcgcacagctgtacatggccgcacatcagcccggcaaggctctgacgtac
tacatgcgcctgcgtgatccatgcgtgtttgatctcattcgcgagtacgatctgctgatc
gatgtgcagcaccacatcggcacgctcgtcgagctcgatcaggaatgcgccggctccact
gagccgcgctccagcgcgcttatgccgctgctcgtgccatatacccactcgattcccatc
cagcgcgccatggcgcagctcgagccctatccgtggtacgcgtacttgtacttggacgcc
ttgtacgagcgtgatccatcgctcgtgacccactatgccatggacctgctgaggctgtac
tgccgctttgactatgcccgactcatgccgtttctgcgcacgatgagctcggcgtactca
ctcaaagacgcctacgacgtctgcgagacctacagctatgtgccggaaatggtgttcctg
cgcggccgaacgggcgatgtcgtgggcgccttgcagctgatcctggagcgcctccagcat
gtcgacatggcgctggactttgtgcggcagcaggacgacgcggagctctgggacacgctg
ctggcctattcacaggacaagccggcctatatccgcggcttgctcgagcaggccagcggc
gagattgaccctgtccgcatcatccgccctatccaggacggcctcgagatacccggccta
cgtccctcgctgatcaagatctttcacaacttccatgcgcagcatgcgctgctgggcgtg
ggcctggctgtcctgcagcgtgatgcgtacgagcgcctcgccgagtacgacacagcctgt
caggcggcgctcgtctgcgacgcacgcaccctgtgtaccgtgtgcctccagccgcttctt
gctgcggcggtgcccatcgtcttgttcttgtgtcgcttgcatgcggcccacctgacctgc
gtcacgtccgcttccatgccgccactcccaccggccgttttcgcacccgtgcatgaaacg
acgacgcagcagtaccggcgcactcgagcgaccacggacctgactcgctcgccggggcga
atagcccaggaacgtgcggaccgacgtgcgtggctctatgcacgacaagcgcgacgcctc
gtgcgtggatgcccagcctgtgccgaggcacagcgcgatcgcctggctgactag

DBGET integrated database retrieval system