KEGG   Malassezia restricta: MRET_3847Help
Entry
MRET_3847         CDS       T06113                                 

Definition
(RefSeq) phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mrt  Malassezia restricta
Pathway
mrt00564  Glycerophospholipid metabolism
mrt00565  Ether lipid metabolism
mrt00590  Arachidonic acid metabolism
mrt00592  alpha-Linolenic acid metabolism
mrt01100  Metabolic pathways
mrt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MRET_3847
   00565 Ether lipid metabolism
    MRET_3847
   00590 Arachidonic acid metabolism
    MRET_3847
   00591 Linoleic acid metabolism
    MRET_3847
   00592 alpha-Linolenic acid metabolism
    MRET_3847
Enzymes [BR:mrt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     MRET_3847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 38740613
NCBI-ProteinID: XP_027486308
Position
VII:complement(119765..122566)
Genome map
AA seq 933 aa AA seqDB search
MTLLHRIRSSPSYLFIKCYLICTLVTLFAARPLSSRLNANGPWTWYESTEGGHGLSSWGR
MQALLASATRRESRASTSTSQAASATDRPSVTGAPPAAQATGLGFWWQERRFPFLFPPPQ
IPLSLAPPVRLPRIPLFERWRLRWHDMSHLRRLVAYDDQDTETFPELEWDARVRCSSELH
DEEKAAIYQRRIHMSSHGANTLAQFLQLPNDEYVHPDDVPLIAIGGSGGGYRAMYGYTGF
LKEAENTGLWQCTMWTSAVSGSCWTLAAYYTIAKCSTDVLVAHLLAMAHEEAHPMSLQAM
DRIARSSHGIYYLLGPLLRKSRNKSMQCRIMDFYATLVLSYQFLPRPLSLFGTDYSYNGP
SSDREPSLQEHSMWTKYEPSEGLSRKSFQWSKVWKRTHIDEGLQPIPIMTGVRRVWRPHS
KAEVAVVEQAPGVERAPLVGSGYDWYEISPLELGCRNIGAWIPTWAYGRAFENGVSTHRA
PEEMLASIVGQCTGAPAGPLTAYISTMLASIPQGTVMSTLLKWVNDFVMMKQWEKRWGNP
IRAADEPNPFYGRGMDDVVVDMREADVTPPPKAVTKPPEAEPAPADAPSQEGAHFLPWDG
RQTSEQINAFFARFPAVELRPRRGSDASASTSLYEHDPETFMAPIEDLEAQAPTEPPRPR
QWRWEHTRRLRLMDSGLSNNLPNHVLARDERQADVIISFDASSDVKTGAAVERIHEFGRE
CGIHIQKRPPKEGEEPPAPSPTSEHDADTASMSPSDMERQWQSEADHIRRAYEPLYAQRF
DGWRLRKDKSTDRAPDVHFVYCPLLPNAAQPGFDPTTAHYSTSYNLIWTADQVRALLRTA
MANVEEGSRAVGVIREAVREAYESRKKTRLEREAQSASRRMARAEASKEAHGAQDPANAS
QHAMSAATDAQVQGAAPSLPIDGPGMLAPPVAG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctgcatcgcatccggtcgtcgccgagctacctgtttataaagtgttatttg
atatgtacgctcgtgacgctatttgctgcgcggccgctgtcttcgcggctgaatgcgaat
ggcccatggacgtggtatgagtcgaccgaaggtggccatggcctgtcgtcgtgggggcgt
atgcaggcgctgctggcgagtgcgacgcggcgcgaaagccgcgcatctacgtcgacgtcg
caggcggcgtccgcgacggaccgcccctcggtcacaggcgcgccaccggccgcccaagcg
acgggcctgggcttttggtggcaggagcggcgctttccgttcctgttcccgcccccgcag
atcccgctgagtttggcgccgccggtgcgtctgccaagaatcccactgttcgagcggtgg
cggctgcggtggcacgacatgtcgcacttgcgccgcctggtcgcgtacgacgaccaggac
acagagacgttcccggagctcgagtgggatgcgcgtgtgcgttgctccagtgagctgcac
gatgaagagaaggccgcgatctaccagcggcgcatccacatgtcgtcgcacggcgccaat
acgctcgcgcagtttctccagctccccaacgacgagtacgtgcaccccgacgatgtgccg
ctgatcgcgattggcggctccggtggcggctaccgcgccatgtacggctacacgggcttc
ctgaaggaggcggaaaacacgggcctgtggcagtgcacgatgtggacgtcggcggtcagt
ggctcctgctggacgctggcggcgtactacacgatcgccaagtgctcgacggatgtgctc
gtggcgcatctgctcgcgatggcccatgaggaggcgcatcccatgagtctgcaggccatg
gaccgcattgcacgctcatcacacggcatctactacctgctggggccgctgctgcgcaag
tcgcggaacaagtcgatgcagtgccgcatcatggacttttatgcgacactcgtcctgtcg
taccagtttctgccgcggccgctctccctgttcggcacggactactcctacaacgggccg
agctcggaccgcgagccgagtctgcaggagcacagcatgtggaccaagtacgagccgagc
gaaggcctcagccgcaagtcgttccagtggtccaaggtgtggaagcgcacgcacatcgac
gaaggactgcagcccatccccatcatgacgggcgtgcggcgcgtgtggcgcccacacagc
aaggccgaagtcgccgtcgtggagcaggcaccaggcgtcgagcgcgcgccactcgtgggc
agtggctacgactggtacgaaatctcgcccctcgagttgggatgccgcaacattggtgcg
tggatcccgacgtgggcgtacggccgcgcatttgagaacggcgtgtcgacgcaccgcgcc
ccggaggaaatgctggcgtcgatcgtcgggcagtgcacgggcgctcccgccggcccgctg
acagcgtacatttccacgatgctggcatcgattccgcagggcacggtcatgtcgacgctg
ctcaagtgggtcaacgactttgtcatgatgaagcagtgggagaagcggtggggcaacccg
atccgcgccgccgatgagcccaatccgttttatggccgtggcatggacgatgtcgtcgtg
gacatgcgcgaggccgatgtgacaccgccgcccaaggccgtcacaaagccgccagaggcg
gagccagcccctgccgacgcgccgtcccaggaaggcgcgcactttctgccatgggacgga
cggcagacgagcgagcagatcaatgccttttttgcgcggttcccggccgtcgagctgcgc
ccgcgccgtggcagcgatgcatcggcgtccacatcgctctacgagcacgaccccgagacg
tttatggcaccgatcgaggatctggaggcacaggcgcccacggagccgccgcgacccagg
cagtggcgctgggagcacacgcgccgtctgcggctcatggacagtggcctgtcgaacaac
ttgccgaatcatgtgctggcccgcgacgagcggcaggccgatgtgatcatctcgtttgat
gcgtcgtcggacgtcaagaccggcgcggcggtggagcgcatccacgagtttgggcgtgag
tgcggcatccatatccaaaagcgccctcctaaagaaggtgaagagcctcctgcaccctcg
cccacctcagaacacgacgcagataccgcgtccatgtcgccgtccgacatggaacggcaa
tggcagagcgaggcggatcacatccgtcgggcgtatgagccgctgtacgcacagcgcttc
gacggatggcgcctgcggaaagacaagtcgacggatcgtgcgccggacgtgcactttgtc
tactgcccccttttgccgaatgccgctcagcccggctttgatccgacgaccgcacactac
agcacctcgtacaatttgatttggacagccgaccaggttcgcgcgctcctgcgcacagcg
atggccaatgtcgaggagggtagtcgtgccgtcggcgtgattcgcgaggccgtgcgcgag
gcctacgagtcgcgcaaaaagacccgtctcgagcgcgaagcacaatcggcctcgagacgc
atggcgcgagctgaagcctccaaagaggcgcacggcgcgcaggatcctgccaacgcgtct
cagcatgccatgtcggcggcgacggatgcccaagtccagggcgctgcgccctccctgcct
atcgacggccctggaatgctggcgccgccggtcgctggatag

DBGET integrated database retrieval system