KEGG   Malassezia restricta: MRET_4019Help
Entry
MRET_4019         CDS       T06113                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mrt  Malassezia restricta
Pathway
mrt00620  Pyruvate metabolism
mrt00630  Glyoxylate and dicarboxylate metabolism
mrt01100  Metabolic pathways
mrt01110  Biosynthesis of secondary metabolites
mrt01200  Carbon metabolism
Module
mrt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRET_4019
   00630 Glyoxylate and dicarboxylate metabolism
    MRET_4019
Enzymes [BR:mrt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MRET_4019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 38740785
NCBI-ProteinID: XP_027486406
Position
VII:complement(390885..392486)
Genome map
AA seq 533 aa AA seqDB search
MSVEGVRILAPVLGEHAQILTPEAIKFLTVLHRNFETERQERLKARAVRQVELDGGKTLD
FLPQTRHIREDPAWRCAPPSPGLRDRRVEITGPVDRKMVINALNSGAYTYMADFEDSNSP
TWANNLDGQVNLRDAINRRVDFKASNGKHYKLRPVHELATLIVRPRGWHLNEESFLVDGK
PISGGLFDFGLFFFHNAHQLVKNGFGPYFYLPKMESHLEARLWNDVFNLSQDYIKMPRGT
IRGTVLIETITAAFEMEEILYELREHSSGLNCGRWDYIFSFIKRQRYNKSAVLPDRATVT
MTCPFMQAYVNLLIQTCHKRGAAAIGGMAAQIPIKGNEKANNAAMDKVRADKLREVLAGH
DGTWVAHPALVPIALEVFNKHMLGPNQYHVRREEVRVSALDLLNPNVDGQITEAGARANV
SALLAYCANWVRGNGCVPINHLMEDAATAEISRISLWQWVFHGSKTVEGKPVTPQFIDQI
IASEAAKLTSLDPNAVDLSRRYLSQQVRAKEPSEFLTTDLTAHLDNSISQSRI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggaaggtgtccgtattctagcgcctgtgcttggtgagcatgcccagatcctc
acacctgaggctatcaagttcttgacagtgctgcaccgcaattttgagacggagcgtcag
gaacgtctaaaggcacgcgctgtccgccaggtcgaactcgatggcggcaagacacttgac
ttcctgcctcagacccgtcacatccgtgaggatcccgcgtggcgctgcgcgccgccctca
cctggtcttcgtgaccgtcgcgttgagatcactggccctgtcgaccgtaagatggtcatc
aatgcccttaattcgggtgcctacacctatatggccgactttgaggactctaactcgcct
acgtgggctaacaaccttgatggccaagtcaacttgcgcgacgctatcaaccgccgcgtg
gatttcaaggctagtaatggcaagcattacaagcttcgccctgttcatgagcttgcaaca
cttattgtccgccctcgtgggtggcacttgaacgaggagtcgttcctcgttgatggcaag
cctatttcgggtggactgtttgactttggactgttctttttccacaacgcccatcagctg
gtgaagaacggctttggaccgtacttctacctgcccaagatggagtcacacctggaagcc
cgtttgtggaacgacgtgttcaacctctcgcaagactacatcaaaatgccgcgtggtacg
attcgtggcaccgttctgatcgagaccataactgctgcctttgagatggaggagattctt
tacgagctgcgcgagcactcctcgggtctcaactgcggtcgctgggactacattttttca
ttcattaagcgtcagcgctacaacaagtcggctgtactgcctgatcgtgctacggtgacg
atgacgtgcccctttatgcaagcctacgtgaacctgctcattcaaacttgccacaagcgt
ggtgctgctgccattggtggtatggctgctcagattcctatcaaaggaaatgagaaggcc
aacaatgctgctatggacaaggtgcgtgctgacaagcttcgtgaggtgctcgccggtcac
gacggtacgtgggtggcacatcctgcgctagtcccgatcgcgctagaggtcttcaacaag
cacatgcttggtcccaaccaatatcacgtccgacgtgaggaggtccgcgtctcggctcta
gacctgctcaaccccaacgtggatggccagatcactgaagctggtgctcgcgccaacgtg
tcggccctccttgcctactgtgctaactgggttaggggcaacggctgtgttccgattaac
cacctcatggaagatgctgccacggccgagatttcgcgtatctcgctctggcagtgggta
ttccacggctccaagaccgtggaaggcaagcctgtcacgcctcaattcattgatcaaatt
attgcgtcggaggctgccaagctcacgagcctggatccgaatgctgtagacctgtcacgt
cgctacctgtcccagcaggtgcgcgccaaggagcccagtgaattcctgaccacggaccta
acggcccatcttgataactcgatctctcaatcgcgtatttaa

DBGET integrated database retrieval system