KEGG   Methanobrevibacter ruminantium: mru_0498Help
Entry
mru_0498          CDS       T01166                                 

Gene name
fbp
Definition
(GenBank) fructose 1,6-bisphosphatase Fbp
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00010  Glycolysis / Gluconeogenesis
mru00030  Pentose phosphate pathway
mru00051  Fructose and mannose metabolism
mru00680  Methane metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01120  Microbial metabolism in diverse environments
mru01130  Biosynthesis of antibiotics
mru01200  Carbon metabolism
mru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0498 (fbp)
   00030 Pentose phosphate pathway
    mru_0498 (fbp)
   00051 Fructose and mannose metabolism
    mru_0498 (fbp)
  Energy metabolism
   00680 Methane metabolism
    mru_0498 (fbp)
Enzymes [BR:mru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     mru_0498 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     mru_0498 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADC46349
UniProt: D3E166
Position
685591..686691
Genome map
AA seq 366 aa AA seqDB search
MKTTVSVIKADIGSVSGHCVSHPALMEKCDEVLANALETGILEDYYITRCGDDIDLIMTH
RNGELNEEVHKTAYDAFIQATEIARDLKLYGAGQDLLSDTFSGNVKGMGPGCAEMEFKER
RSDPVIVYCMDKTEPGAFNLPIFKIFADPFNTAGLVIDPSLHDGFSFEVFDVMEHKKVVL
DCPEEMYDLLALIGSTGRYVIKRVFKKNGEIAAAVSTDKLNMLAGEYVGKDDPVAIVRAQ
SGFPANGECVEPFAFPHMVSGWMRGSHNGPMMPTSQEEANPIRFDGPPRVVGLGFQVTDA
KLVGPVDLFDDPAFDETRRQSANIATYIRRHGPFEPHRLPSEEMEYTSLPGVMEKLEPRF
EDMDDD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactactgtaagtgtaatcaaagcggatattggaagtgtttccggacactgtgta
tctcatcctgcattaatggaaaaatgtgatgaggttttagctaatgctttagaaactgga
attcttgaagattactatataacccgttgtggtgacgacattgatttaatcatgacccac
agaaacggtgaattgaacgaagaagttcacaaaactgcatatgatgctttcattcaagca
actgaaattgcaagagacttaaaattatacggtgcaggtcaagacttattatctgacact
ttctctggaaacgttaaaggtatgggtccaggctgtgcagaaatggaatttaaagaaaga
agaagtgaccctgtaattgtatactgtatggataagactgaacctggtgcattcaacttg
cctatattcaagatctttgcagacccattcaacactgcaggacttgtaattgacccaagt
ttacatgacggattcagttttgaagtctttgatgtaatggaacacaaaaaagtagtatta
gactgtcctgaagaaatgtacgacttacttgcattaatcggttccactggaagatacgta
attaaaagagtatttaagaaaaacggtgaaatcgcagcagcagtaagtactgacaaatta
aacatgttagctggtgaatacgttggtaaagacgaccctgtagctattgtaagagctcaa
tctggtttccctgctaatggtgaatgtgtagaaccatttgcattccctcacatggtaagt
ggatggatgagaggttcccacaacggtcctatgatgccaaccagccaagaagaagctaac
ccaatcagatttgacggacctcctagggttgtaggtttaggtttccaagtaactgatgct
aaattagtcggtcctgtagacttatttgacgaccctgcatttgatgaaaccagaagacaa
tctgcaaacattgcaacctacatcagaagacacggtccattcgaaccacacagattacca
tctgaagagatggaatacacttcattacctggcgtaatggaaaaattagaacctaggttc
gaagatatggatgatgactaa

DBGET integrated database retrieval system