KEGG   Methanobrevibacter ruminantium: mru_0548Help
Entry
mru_0548          CDS       T01166                                 

Gene name
porC
Definition
(GenBank) pyruvate ferredoxin oxidoreductase gamma subunit PorC
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00010  Glycolysis / Gluconeogenesis
mru00020  Citrate cycle (TCA cycle)
mru00620  Pyruvate metabolism
mru00633  Nitrotoluene degradation
mru00640  Propanoate metabolism
mru00650  Butanoate metabolism
mru00680  Methane metabolism
mru00720  Carbon fixation pathways in prokaryotes
mru01100  Metabolic pathways
mru01120  Microbial metabolism in diverse environments
mru01130  Biosynthesis of antibiotics
mru01200  Carbon metabolism
Module
mru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mru_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0548 (porC)
   00020 Citrate cycle (TCA cycle)
    mru_0548 (porC)
   00620 Pyruvate metabolism
    mru_0548 (porC)
   00640 Propanoate metabolism
    mru_0548 (porC)
   00650 Butanoate metabolism
    mru_0548 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_0548 (porC)
   00680 Methane metabolism
    mru_0548 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    mru_0548 (porC)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     mru_0548 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Torsin
Motif
Other DBs
NCBI-ProteinID: ADC46399
UniProt: D3E1I8
Position
738681..739202
Genome map
AA seq 173 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINL
RYQVYNPDHVIVLDDGLLNVVDVYSGLKENGEVIINTHEKVESESHKVFDVDATGIALEI
LGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPGPIGEKNAVAAQKAYDMA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcgctttcacggacgtggaggacaaggtgctgtaactgcagcagaaatt
ttggctaaagcagcatttaaagatggtaaatactctcaagcgttcccattcttcggtgta
gaaagaaggggagctcctgttatggcatttaccagaatcgatacagagcctatcaaccta
agatatcaggtatacaatcctgaccatgtgatagttcttgacgacggtctcttaaatgtt
gtggacgtctattccggattaaaagaaaatggtgaagtaattataaacactcatgaaaaa
gtcgaatctgaaagtcacaaggtatttgatgttgatgctacaggcatcgcattggaaatt
ttaggtgtaaacatcgttaacaccattattttaggatactttgctaaaaagactggtgaa
gtaagtattaattcacttattgaagtaataaaggaaactttcccaggtccaattggagag
aaaaacgcagtggcagctcaaaaggcttatgatatggcttag

DBGET integrated database retrieval system