KEGG   Methanobrevibacter ruminantium: mru_1544Help
Entry
mru_1544          CDS       T01166                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00860  Porphyrin and chlorophyll metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01120  Microbial metabolism in diverse environments
Module
mru_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    mru_1544 (hemD)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     mru_1544 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF3692
Motif
Other DBs
NCBI-ProteinID: ADC47394
UniProt: D3E4D3
Position
2007320..2008096
Genome map
AA seq 258 aa AA seqDB search
MKKKIAITRPQERSKAAKEFIENYGSEAIIVPTLELKLENTESLKNLMEKSNELDWLIFT
SVSSIESIFEFYPDFLDKLNPECKIATIGTKTAELGIKKGLPIDIIPKDYTAEGLLEEFE
RIDLNNKNVGVPRTFSARTILPEGLKNMGANVILAESYKSVIPEDTSKIEKLIQCILDEK
IDGITFTSPLTVSNLFEIAKDEDKDNLVEKLSTTTLTVAIGPITGNILNQLGVNHIYPKR
YTVKDMIDLMFRELNNRE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatagcaatcacaagacctcaagaacggtcaaaagccgcaaaggagttt
atagaaaactatggatccgaagcaatcatagtcccaacacttgaattgaaactggaaaat
accgaatcactaaagaacctgatggaaaaatccaatgagctagactggttgatatttaca
tcagtaagttcaatcgaatcaatctttgaattctatccggacttcttggacaagttgaat
ccagagtgtaaaattgcaaccataggtactaaaactgcagaacttggtataaaaaaagga
ctccctatagacatcatacctaaagattatactgctgaaggactgcttgaagaatttgaa
agaatcgacttaaataataaaaatgttggcgtccctaggacattttctgcaaggactatt
ttacctgaaggacttaaaaatatgggggcaaatgtgatcttggctgaaagttataaatca
gtcattccagaggacacaagcaagatagaaaaactgattcaatgcatcttagatgaaaag
attgacggaatcacatttacaagtcctttaactgtatcaaacctttttgaaatagctaaa
gatgaagataaggataatctagttgaaaagttatctacaacaacccttactgtagctatt
ggaccaattacaggtaatatattgaaccaattaggagtaaatcacatctatccaaaaagg
tatactgtaaaagacatgattgacttgatgtttagggagttaaacaatagggaataa

DBGET integrated database retrieval system