KEGG   Methanobrevibacter ruminantium: mru_1638Help
Entry
mru_1638          CDS       T01166                                 

Gene name
cbiP
Definition
(GenBank) cobyric acid synthase CbiP
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00860  Porphyrin and chlorophyll metabolism
mru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    mru_1638 (cbiP)
Enzymes [BR:mru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     mru_1638 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase DJ-1_PfpI Peptidase_C26 MobB
Motif
Other DBs
NCBI-ProteinID: ADC47488
UniProt: D3E4U4
Position
2125503..2127143
Genome map
AA seq 546 aa AA seqDB search
MTKCLMIQGTASNAGKSLIVAALCRIYTKRGYKVAPFKSQNMSLNSYTTKENKEIAIAQV
LQAKAANIEPTVDMNPILLKPKGESCSQVIIQGEAVGNKDFFRKYDKTKATQRDIDNNLM
DDEDYRIIAKEAVIDSLNNLKEDYDIIIMEGAGSPAEINLREGDLANMGAAEIADANVLL
VGDIDKGGVFASIAGTFLLLDDADRSRFKGVIINKFRGKQELLCSGIERLEEIIQVPVLG
IVPYAENLQLPEEDSASLKEHNWTKEFKNNDDHIIIGVVKLPKIANFTDIDPFDTEDDVE
VRMIEVHNYKDKIKDIDALILPGTRNSTEDIMELEKTGLAQEIRKLSNESKIPIIGICGG
YQILGNKIYDKNHKESKLDEVEGLGLLDIESEFIRESKVVKQSIGRIEINDNITGLNNSD
ENNIFYEIFSKINGETVSGYELHEGTTNLISAKPLFKIEKGIGNNDNDQFDGAYSKNVFG
TYFHGIFNNYNLRREFLNHLRKNKGLDEKTGEDPYETSVENSLEKLANIVEEALDMDYID
KLVFDE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatgtttaatgattcaaggaacagcatcaaatgctggaaaaagtttgattgtt
gcagcactttgcagaatatacacaaaaagaggatacaaggttgctccattcaagtcacag
aatatgtctttaaattcatacactacaaaggaaaataaggaaatagccattgcacaggtt
ttgcaggcaaaggctgcaaatatagagcctacagtagatatgaacccaattctcctaaag
ccaaagggagaatcatgctcacaagttatcatacaaggagaagcagttggaaacaaggac
ttctttagaaaatatgataagacaaaggccacccaaagggatatagacaataatctgatg
gatgatgaggactatagaatcattgcaaaggaagctgtaatagactcattaaacaatctc
aaggaagattatgacataatcattatggaaggtgcaggatctcctgcagaaatcaaccta
agggaaggagaccttgcaaatatgggagctgcagagattgcagatgcaaatgtacttctt
gtaggtgacattgacaagggaggagtctttgcatcaatagctggaacattcctattgctt
gacgatgcagaccgctcaagatttaagggagtcattataaacaagttcagaggaaagcag
gaattattatgctctggaatcgaaaggctcgaagaaatcattcaggtcccagtccttgga
attgttccttatgctgaaaacctccagctaccagaagaggactctgcatccttaaaggag
cacaactggacaaaggaatttaagaataatgatgatcacataataattggagttgtaaag
cttccaaagattgccaacttcacagacatagacccatttgacacagaagatgatgttgaa
gtgagaatgattgaagtccataattacaaagacaaaatcaaggacattgatgcattgatc
ttaccgggtacccgtaactccactgaagacattatggaacttgaaaagaccggtttggca
caagagataaggaaactgtcaaatgaatccaagattccaatcatcggaatctgcggagga
taccagatattgggaaacaagatctatgataaaaaccataaggaatccaaacttgatgaa
gttgaaggattaggtcttttagacattgaaagtgagtttataagggaaagcaaggtcgta
aagcaaagcataggtagaatagaaataaatgataatatcactggtctaaataattccgat
gaaaataatatcttttatgaaatattctctaagatcaatggggaaactgtaagcggctat
gagttacatgaaggcactacaaatcttataagcgccaagccattatttaaaatagaaaag
ggaattggaaataatgacaatgaccaatttgatggtgcttacagcaagaatgtatttgga
acctatttccatggaatatttaataattataatcttagaagagagtttttaaaccattta
agaaaaaataagggtttggatgaaaaaactggtgaagatccatatgaaacaagcgttgaa
aattctcttgaaaaattagcaaatattgtagaagaagctcttgatatggattatattgat
aaattggtttttgatgaataa

DBGET integrated database retrieval system