KEGG   Methanobrevibacter ruminantium: mru_1822Help
Entry
mru_1822          CDS       T01166                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00010  Glycolysis / Gluconeogenesis
mru00051  Fructose and mannose metabolism
mru00562  Inositol phosphate metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01120  Microbial metabolism in diverse environments
mru01130  Biosynthesis of antibiotics
mru01200  Carbon metabolism
mru01230  Biosynthesis of amino acids
Module
mru_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_1822 (tpiA)
   00051 Fructose and mannose metabolism
    mru_1822 (tpiA)
   00562 Inositol phosphate metabolism
    mru_1822 (tpiA)
Enzymes [BR:mru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mru_1822 (tpiA)
Exosome [BR:mru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mru_1822 (tpiA)
  Exosomal proteins of bladder cancer cells
   mru_1822 (tpiA)
  Exosomal proteins of melanoma cells
   mru_1822 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh NMO Glu_synthase His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: ADC47672
UniProt: D3DZJ4
Position
complement(2354730..2355404)
Genome map
AA seq 224 aa AA seqDB search
MSLKTPVVILNFKTYLESSGQKALDLANALESAGEESGITMVAVPQAIDIYRIKEETSIP
VLAQHIDAVSPGGHTGSNLFESFVANGVDGTLLNHSECRMTLADIAEVVQKTKGADLISC
VCTNNIETSMAAATLAPDFVAVEPPELIGTGIPVSKADPEVVEGSVSKVKAINKDVQVLC
GAGISTGEDMAAAIDLGAEGVLLASGIIKAENPKDALLDLVSKI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcttaagacacctgttgttatattaaattttaaaacttatttggaatccagcggt
caaaaggcattggatttggcaaatgctttagaaagcgctggagaagaatctggaattact
atggttgctgtaccacaggccattgatatctataggattaaagaggaaacaagcattcct
gttttagctcaacatattgatgcagtttcccctggaggccatactggaagcaacttattc
gaaagctttgtggcaaatggtgttgacggaaccttattgaatcactctgaatgcagaatg
actcttgcagatattgcagaggtcgttcaaaaaacaaagggagctgatttaatctcatgt
gtttgcacaaacaatattgaaacaagtatggcagctgcaactcttgctccagattttgtt
gctgtagagccacctgaacttattggaactggaatacctgtttctaaggcagaccctgaa
gttgtagaaggaagcgtatctaaagtaaaggctattaataaggatgttcaggtcttatgc
ggtgctggaatctccactggtgaggatatggctgcagctattgatttaggtgctgaaggt
gtgctattggcttctggaattataaaagcggaaaatcctaaagatgccttattggatttg
gtaagtaagatttag

DBGET integrated database retrieval system