KEGG   Methanobrevibacter ruminantium: mru_1856Help
Entry
mru_1856          CDS       T01166                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase Gap
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00010  Glycolysis / Gluconeogenesis
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01120  Microbial metabolism in diverse environments
mru01130  Biosynthesis of antibiotics
mru01200  Carbon metabolism
mru01230  Biosynthesis of amino acids
Module
mru_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_1856 (gap)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     mru_1856 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C TrkA_N Sacchrp_dh_NADP F420_oxidored CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADC47706
UniProt: D3DZM8
Position
complement(2388577..2389593)
Genome map
AA seq 338 aa AA seqDB search
MKSVAINGFGTIGKRVADAVAAQDDMKVIGVSKTRPNFEARTAVEEKGYPLYIGIPEREP
LFKEAGIEIAGTVEDMIQEADIVVDCTPGNIGPQNLEMYKKAGVKAIYQGGEDHELTGLS
FNSFANYDDSYGADYARVVSCNTTGLTRTLHTLNPLVDIKKVRAVMVRRGSDPSEIKKGP
INAIVPNPPKVPSHHGPDVQTVMKGIDVTTMALLVPTTLMHQHNLMVEIGNDVTKEEVIE
ALEKRSRVMVVEAAAGLDSTAALMEYAKDLGRSRNDLYEIPVWKESINVVDNELFYMQAV
HQESDVVPENVDAIRAMLEMESDNEKSIAKTNKAMGIF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgtagctattaatggattcggaactataggtaaaagagtggctgatgctgta
gccgctcaagatgacatgaaagttattggtgtaagcaaaaccagacctaactttgaagca
agaactgctgttgaggaaaagggatatcctttatatataggaattccagaaagagagcct
ctatttaaggaagcaggaatagaaattgcaggaactgttgaagacatgattcaagaggca
gacattgtagttgactgtactcctggaaacatcggccctcaaaaccttgagatgtataag
aaagctggcgttaaggctatttaccaaggtggagaagaccatgaactaaccggattgtca
tttaactcctttgctaactatgatgattcatatggtgcagactatgcaagagtcgtatcc
tgtaacacaaccggtctaacccgtaccttgcacacccttaatccattggttgacattaag
aaagttcgtgctgtaatggtaagaagaggatccgacccatctgaaatcaagaagggtcct
atcaacgctattgtacctaaccctccaaaggtcccttcccaccacggtcctgacgttcag
actgtaatgaaaggcatagatgttactacaatggctttgcttgttcctactaccttgatg
caccaacacaaccttatggttgagattggaaatgatgtaactaaggaagaagtaattgaa
gctcttgaaaaacgttccagagtaatggttgttgaagcagctgctggccttgactcaact
gctgcacttatggaatatgctaaggatttaggaagaagcagaaatgacttgtatgagatt
cctgtatggaaagagtccattaatgtagtggataatgaactcttctatatgcaagctgtg
caccaagaatctgatgtggttcctgaaaacgtggatgctattcgtgcaatgcttgaaatg
gaatctgataatgaaaaatccattgcaaaaaccaataaagcaatgggaatcttttaa

DBGET integrated database retrieval system