KEGG   Methanobrevibacter ruminantium: mru_1921Help
Entry
mru_1921          CDS       T01166                                 

Gene name
mtrC
Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit C MtrC
  KO
K00579  tetrahydromethanopterin S-methyltransferase subunit C [EC:2.1.1.86]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00680  Methane metabolism
mru01100  Metabolic pathways
mru01120  Microbial metabolism in diverse environments
mru01200  Carbon metabolism
Module
mru_M00567  Methanogenesis, CO2 => methane
mru_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mru00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    mru_1921 (mtrC)
Enzymes [BR:mru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     mru_1921 (mtrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrC
Motif
Other DBs
NCBI-ProteinID: ADC47771
UniProt: D3E047
Position
complement(2465267..2466085)
Genome map
AA seq 272 aa AA seqDB search
MSAGGSGAPAEGAVNANVMLAVGIIGGLIGIYASSFEPTIGPVIACLGAVCAILWGVLAI
RSVASYGLGTGVPSIGYMSLGIGVIGALAGVGIIAAFKLKGLEMLGPILALVFAMLIGLL
VAIVAKKIVGMKIPVMERCTAEIAGAAALAVLGFSSAIAGGYSIDLLLTAVVAPGFIALF
YILVTMAIQHPFNACLGPNEDQVRTLKCGASTAFLTMIITGILAISAGGYAWFAILVVGL
IGWYVSFKMFVNASYEAAASVKWSGLWPKVEE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggaggaagtggagcacctgcagaaggtgctgtaaatgctaatgtaatgtta
gcagttggtattatcggtggattaattggtatttatgcgtcaagttttgagcctactatt
ggaccagtcattgcatgtcttggtgcagtttgtgcaattctttggggagttcttgctatt
cgtagtgtagcaagttacggtttaggtactggtgtaccttctattggttacatgtcttta
ggtataggtgtaatcggtgcattagcaggtgtaggtataattgcagcatttaaattaaaa
ggattagaaatgctcggaccaatacttgcattagtatttgcaatgctcattggtttatta
gttgcaattgttgctaagaagattgttggaatgaaaatccctgttatggaaagatgcaca
gctgaaatcgctggtgctgctgctttagctgttctcggattctcctctgcaattgcaggt
ggatactctattgatttattattaaccgctgttgtagctcctggattcattgctctcttt
tacatattagttactatggctatccaacacccattcaacgcatgtttaggacctaacgaa
gatcaagttagaactcttaaatgtggtgcatccactgcattcttaaccatgattattact
ggtattctcgcaatttccgctggaggatacgcatggtttgcaattttagttgttggactt
atcggctggtacgtctcatttaaaatgtttgttaatgcttcctacgaagctgcagcatct
gttaaatggtccggattatggccaaaagttgaggaataa

DBGET integrated database retrieval system