KEGG   Methanobrevibacter ruminantium: mru_1928Help
Entry
mru_1928          CDS       T01166                                 

Gene name
mcrB
Definition
(GenBank) methyl-coenzyme M reductase beta subunit McrB
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00680  Methane metabolism
mru01100  Metabolic pathways
mru01120  Microbial metabolism in diverse environments
mru01200  Carbon metabolism
Module
mru_M00567  Methanogenesis, CO2 => methane
mru_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mru00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    mru_1928 (mcrB)
Enzymes [BR:mru01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     mru_1928 (mcrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ADC47778
UniProt: D3E054
Position
complement(2472306..2473637)
Genome map
AA seq 443 aa AA seqDB search
MAKFDDKVDLYDDRGSLVESDVPIEALSPLRNPAIKNIISGVKRTVAVNLEGIEKSLKTA
SVGGAKSKILGREMDLDIVAQADSINASLKEMLQVTEDDDTKCEILSGGKRILVQIPTIR
LDSSAEYSVATLATATALTQAIIKEFDVSMYDANMVKAAILGRYPQSVEYMGSNLKTMLD
VPQKLEGPGYSLRNIKANDFVAATLKNTLQATALASIFEQTAMFEMGDAVGAYERMHLLG
LAYQGLNADNMVLGLVQDNAKEGTVGSIVQDTIAKAEADGVIAVEKELTDYNMYATNDAA
KWNAYAAAGCTAAIMVNVGAARAAQGIPSTILYFNDNIEFATGLPGIDFGRAEGVAVGFS
FFSHSIYGGGGPGLFNGNHVVTRHSKGFTIPCVAAGMALDAGTQLFSPEATSGLIKEVYS
EIDEFREPLKYVALAAAEIKGDI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagtttgatgataaagtcgatttatacgacgacagaggttcattagtcgaatct
gatgtaccaatcgaagctctaagtccgttacgtaaccctgctattaagaacattattagc
ggtgttaaaagaactgtagctgtaaacttagaaggtatcgaaaaatctttaaaaactgct
tccgttggtggagcaaaatctaaaatcttaggaagagaaatggatcttgacattgttgct
caagctgactccattaacgcttctttaaaagaaatgcttcaagtaactgaagacgatgat
actaaatgtgaaatactctctggtggaaaaaggattttagtccaaattccaactatcaga
ttagattcttccgcagaatactccgtagcaaccttagctaccgcaactgcattaacccaa
gctattatcaaagagtttgacgtaagcatgtacgacgcaaacatggtaaaagctgctatc
ttaggaagatacccacaatctgtagaatacatgggatccaacttaaaaaccatgttagac
gtaccacaaaaattagaaggtccaggttactctttaagaaacattaaagcaaacgacttc
gtagctgctaccttaaagaatactttacaagcaactgctcttgcaagtatctttgaacaa
actgctatgtttgaaatgggtgacgcagtcggtgcatacgaaagaatgcacttattaggt
ttagcttaccaaggattaaacgcagacaacatggtattaggtctcgtacaagacaacgca
aaagaaggaaccgtaggttctatcgtacaagacaccattgctaaagctgaagctgatggt
gttatcgctgtagaaaaagaattaaccgactacaacatgtacgcaaccaacgatgcagct
aaatggaacgcatacgctgctgctggatgtactgctgctattatggttaacgtaggtgca
gcaagagctgctcaaggtattccatctactattttatacttcaacgacaacatcgaattc
gctaccggtttacctggtattgacttcggtagagctgaaggtgtagctgttggattctct
ttcttctctcactctatctatggtggaggaggtcctggtttattcaacggtaaccacgta
gtaaccagacacagtaaaggatttaccatcccttgtgtagctgctggtatggctttagat
gctggtacccaactcttctctccagaagcaacttctggtttaattaaagaggtatacagt
gagattgacgaattcagagaaccactcaaatatgttgctttagcagctgctgagattaaa
ggtgacatctaa

DBGET integrated database retrieval system