KEGG   Mycobacterium sp. JS623: Mycsm_00523Help
Entry
Mycsm_00523       CDS       T02423                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00630  Glyoxylate and dicarboxylate metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01200  Carbon metabolism
Module
msa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_00523
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mycsm_00523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: AGB20973
UniProt: L0IQ49
Position
563552..564838
Genome map
AA seq 428 aa AA seqDB search
MSTVGQPKSAEEIQKDWDTNPRWKGITRTYTPADVVALQGSVVEEATLARRGAEVLWNQL
HDMEFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALMRADQIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADAPTLVIARTDAEAATLITSD
VDERDRPFITGERTAEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFAEG
VKSEFPDQMLAYNCSPSFNWRKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFDAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALSG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggccagccaaagtccgccgaagagatccagaaggactgggacaccaat
ccgcggtggaagggcatcacccgcacctacacccccgccgatgtggtggccctccagggt
tccgtcgtcgaggaggccaccctggctcgccgcggcgccgaggtgctgtggaaccagctg
cacgacatggagttcgtcaactcgctcggcgcgctgaccggcaacatggccgttcagcag
gtccgtgccggcctgaaggccatctatctgtcgggttggcaggtcgccggtgacgcgaac
ctgtccggccacacctacccggaccagagcctctacccggccaactcggtgccgcaggtg
gtccgccgcatcaacaatgcgctgatgcgcgccgaccagattgcgaaggtcgagggcgac
acctccgtcgagaactggctggccccgatcgtcgccgacggtgaggccggcttcggcggt
gcgctcaacgtctacgagctgcagaaggccatgatcgctgcaggcgtcgcggggtcgcac
tgggaggatcagctggcgtcggagaagaagtgcggtcacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcacgctgacctcggcccgcctcgccgccgacgtcgccgac
gcgccgaccctcgtcatcgcccgcaccgacgccgaggccgccacgctgatcacctccgat
gtcgacgagcgcgaccgtccgttcatcaccggtgagcgcaccgctgagggcttctaccgg
gtgcgcaacggcctcgagccgtgcatcgcccgcgctaaggcctacgcgccctactccgat
ctgatctggatggagaccggcacgccggacctcgagctggccgcgaagttcgccgagggc
gtcaagagcgaattcccggaccagatgctggcctacaactgctcgccgtcgttcaactgg
cgcaagcacctggatgacgcgacgatcgcgaagttccagaaggagctcggcgcgatgggc
ttcaagttccagttcatcacgctggccggcttccacgccctgaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgaa
ttcgacgccgaggagcggggttacaccgcgacgaagcaccagcgcgaggtcggcgcaggc
tacttcgaccggatcgccaccaccgtggacccgaactcgtcgacgaccgcgctgagcggt
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system