KEGG   Mycobacterium sp. JS623: Mycsm_01208Help
Entry
Mycsm_01208       CDS       T02423                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00240  Pyrimidine metabolism
msa00983  Drug metabolism - other enzymes
msa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mycsm_01208
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Mycsm_01208
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mycsm_01208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AGB21628
UniProt: L0IRZ3
Position
1221997..1223298
Genome map
AA seq 433 aa AA seqDB search
MTAFAFDAPTVIRTKRDGGVLSDAAIDWVIDGYTHGRVADEQMSALLMAIFLRGMTGAEI
ARWTAAMVDSGERLDFTDLRRDGKPLALVDKHSTGGVGDKITIPLVPVVMACGGAVPQAA
GRGLGHTGGTLDKLESIPGFTAEISKAQIRQQLCDLGAAIFAAGELAPADRKIYALRDVT
ATTESLPLIASSVMSKKIAEGTRALVLDSKVGSGAFLGTEAESRELARTMVELGVAEGLV
TRALLTGMETPLGRTVGNAVEVEESLEVLAGGGPADVVELTLALATEMLDAAGLDAIDPA
QTLKDGSAMDRFRALVAAQGGDLSRPLPIGAYSETISAPRDGTMGLIDAMAVGLTVWRLG
AGRSAPGEQVQCGAGLRIHRRPSEAVAAGEALFTLYTDTPERFEAAMAELDGAWSVGDTA
PAARPLIIDRIVA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgttcgcatttgacgcgccaaccgttattcggaccaaacgcgatggcggcgtc
ttgtccgacgccgcgatcgattgggtgatcgacgggtatacccacggccgcgtcgccgac
gaacagatgtcggcgttgttgatggccatcttcctgcggggaatgaccggtgccgagatt
gcccgctggacggccgcgatggtggattccggtgagcggttggactttacggatctgcgg
cgcgacggcaagccattggcattggtggacaagcactccactggcggcgtcggcgacaag
atcaccattccgcttgttcccgtcgtaatggcatgtgggggagcggtgccacaggccgcg
gggcgcggcctcgggcacaccggcggcaccctcgacaagctggagtccattccgggtttc
accgctgagatatcgaaagcccaaatccgccaacaactttgcgacctcggcgcggcgatt
ttcgccgcgggcgagctggcacccgcggaccggaagatctatgcgctgcgcgatgtcacc
gcgaccaccgagtcgctgccgttgatcgccagctccgtgatgagcaagaagatcgccgag
ggcacccgggccctggtgctcgacagcaaggtcggcagtggggcatttctgggcaccgaa
gcagagtcgcgcgagttggcccgaacgatggtggagctgggcgtcgccgaggggctggtg
acccgcgcactgctgaccggcatggagacgccgttgggccgcaccgtcggcaacgcggtc
gaggtggaggaatcgctggaggtgctcgcggggggaggtccggccgatgtcgtcgagctg
acgctggcactggccaccgagatgctcgacgccgcgggtcttgacgcgatcgatcccgcg
cagaccctgaaggacggctcggcgatggaccggtttcgcgcgcttgtcgccgcgcagggt
ggcgacttgtcccgaccgctgccgatcggtgcgtattccgagaccatctcggcgccgcgc
gatggcacgatgggactcatcgacgcgatggcggtgggactgacggtgtggcggctcggc
gcgggccgctccgccccgggtgagcaggtgcagtgcggcgccgggctgcgcattcatcgc
cgtcccagcgaggccgtcgccgcaggtgaagcgttgttcacgctctacaccgacacccct
gaacggttcgaggccgcgatggccgaactggacggcgcgtggagcgtcggcgatacggcg
cctgccgcccggccgctgatcatcgatcggatcgtggcgtga

DBGET integrated database retrieval system