KEGG   Mycobacterium sp. JS623: Mycsm_01981Help
Entry
Mycsm_01981       CDS       T02423                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00360  Phenylalanine metabolism
msa00362  Benzoate degradation
msa00621  Dioxin degradation
msa00622  Xylene degradation
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
msa01220  Degradation of aromatic compounds
Module
msa_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mycsm_01981
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_01981
   00622 Xylene degradation
    Mycsm_01981
   00621 Dioxin degradation
    Mycsm_01981
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Mycsm_01981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm IRS
Motif
Other DBs
NCBI-ProteinID: AGB22352
UniProt: L0IVM3
Position
complement(1963909..1964946)
Genome map
AA seq 345 aa AA seqDB search
MNRRLYIQDVTLRDGMHAIRHRISTHDVGRIASALDAAGVDAIEVAHGDGLAGGSVNYGP
GSHTDWDWIEAAAANIRNAVLTSLLLPGIGTIAELKRAHDLGVRSVRIATHCTEADISAQ
HIATARELGMDVSGFLMMSHMAAPAQLAAQAKLMESYGAHCVYVTDSGGRLTMDGMRERV
SAYRDVLDPSTQIGVHAHENLSLSVANSIVAVDEGVTRVDASLAGQGAGAGNTPIEAFVA
VADLQGWHHGCDLLALQDAADDLVRPLRDRPVQVDRETLTLGYAGVYSSFLRHAENASRR
YGIDARTLLLEVGRRGLVGGQEDMILDIALDLLASAPNEGAPLST
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgactgtatatccaggacgtcaccttacgggacgggatgcacgcgatccgc
caccgcatcagcacccatgacgtcggccgcatcgcgtccgccctcgatgcggccggtgtc
gacgcgatcgaggtcgcccatggtgatggccttgccggaggctcggtgaactacggtccc
ggcagccacaccgactgggactggatcgaagcggccgcagccaacattcgcaacgccgtg
ctcacctccttgttgctgcccggcatcggcaccatcgccgaactcaaacgcgcacatgat
ctcggcgtgcgctcggtgcgcatcgccacccactgcaccgaagccgacatctcagcccag
cacatcgccaccgcgagagagctcggcatggatgtatccgggttcctgatgatgagccac
atggccgcgccggcacagcttgccgcacaggccaaactgatggaatcctatggcgcccac
tgtgtatacgtcaccgactcgggtgggcgcctaacgatggacggtatgcgtgaacgtgtc
agcgcgtaccgcgatgtcctcgatccaagcacgcagatcggcgtacacgcgcacgaaaac
ctctcgctgtcggtggccaacagcatcgtcgccgtcgacgaaggcgtgacccgcgtcgac
gcgtcactggccgggcagggcgccggcgccggaaacacccccatcgaggcgttcgtcgcg
gtcgccgatctgcaaggctggcaccacggttgcgacctccttgcactgcaggacgcggcc
gacgacctggtgcggccgctgcgcgatcgacctgttcaggtcgaccgggagacgctcacg
ctcggctacgcaggcgtgtattcgtcattcctgcgacacgccgaaaacgcttcccgccgt
tatggaatcgacgcgaggaccctgttgctggaggtcggtaggcgtggccttgtcggcggc
caagaagacatgatccttgacatcgcactcgatctattggcgagtgcgcccaacgagggt
gcgccgctttccacatag

DBGET integrated database retrieval system