KEGG   Mycobacterium sp. JS623: Mycsm_02464Help
Entry
Mycsm_02464       CDS       T02423                                 

Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00020  Citrate cycle (TCA cycle)
msa00620  Pyruvate metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_02464
   00620 Pyruvate metabolism
    Mycsm_02464
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Mycsm_02464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGB22799
UniProt: L0IV36
Position
2424384..2425904
Genome map
AA seq 506 aa AA seqDB search
MSDPKAARTDVVLVGAGIMSATLSALLQQVEPNWSITLVERLDGAGAESSYAWHNAGTGH
AGLCELNYTPERPDGSIETTKAVQVNEQFQVTRQFWAYAVENGLLPDVRSFLNPIPHVSF
VRGAGAVGYLKRRHDALVGNPLFASMEFIEDTDEFAKRLPLMAEGRDLSDPVALAWAQDG
TDVDFGAVSRRLIGRAAQRGMVTLFGHEVRDLTRQSDGSWTLSVVNRRTGGKRKLNAKFV
FVGAGGGTVPLLQKSRIREANGFGGFPVGGAFLRTDRPDLTTAHKAKVYGQPPPGAPPMA
GSHLDTRVINGKSWLVFGPFGSWSPKFLKHGRLTDLPFSVKPNNVAPILKVGVAQAGFVK
YLIGQLLQSDSERMHILREFAPRAVDSDWELDAAGQRVQVIRPVKGKGGVLDFGTTVLSS
ADGTIAGLLGASPGASTAVPAMLDVMERCFADRYPSWLPKLKEMVPSLGTELSNEPALFE
EVWSWGTKVLKLDEQLDSVRNATAAE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccgaaggccgcacggactgacgtcgtcctggtgggcgccggcatcatgagc
gccacactctccgcgctgttgcagcaggtggaaccgaactggtcgatcacgttggtcgag
cgccttgacggtgctggcgccgaaagcagctatgcgtggcacaacgcggggaccggtcat
gcggggttgtgcgagctgaactacacgcccgagcggcccgacggctcgatagagaccacc
aaggcggttcaggtcaacgagcagtttcaggtgacgcggcaattctgggcgtacgcggtc
gagaacgggctgctgcccgatgtgcgcagcttcctcaaccccattccgcacgtcagcttc
gtgcgtggcgcgggcgccgtcggttacctgaaacgccggcacgacgcactcgtcggcaat
ccgttgttcgcgtcgatggagttcatcgaggacacagatgaattcgccaagcgactgccg
ctgatggccgagggccgtgatctctccgatccggtggcgctggcctgggcgcaggacggc
accgacgtcgacttcggggcagtgtcgcgacggctcatcggccgcgcggcgcaacggggg
atggtcacgctgttcggtcacgaagtgcgtgatctcaccaggcaatccgatggcagctgg
accctgtccgtcgtcaacaggcgaaccggcggcaagcgaaagctcaacgccaagttcgtg
tttgtcggagccggtggcggcacggtgccgcttctgcagaagtcgcggatacgggaagcc
aacgggttcggcggttttccggtcggcggcgcgttcctgcgcacggatcggcccgatctg
accaccgcgcacaaggccaaggtctacggccagccaccgccgggtgcaccgccgatggcg
ggttcgcacctggacacccgcgtcatcaacggcaagtcctggctggtgttcggaccgttc
gggagttggtcgcccaaattcttgaagcacggccggctcaccgatcttccgttctcggtg
aagcccaacaacgtcgcgccgatcctcaaggttggggtcgcccaggcgggattcgtgaaa
tatctgatcggccagctactgcagtccgacagcgagcggatgcacatattgcgcgaattc
gccccccgcgcagtcgattccgattgggaactggacgccgcgggtcagcgggtgcaggtg
atccggcccgtcaagggcaagggcggggtgctggacttcggcacaacggtgttgtcctcg
gccgacggcaccatcgcggggctgctgggcgcctcgccgggagcctctactgcggtgcct
gcgatgctcgacgtcatggagcgctgtttcgccgaccgctatccgtcctggctgcccaag
ctgaaagagatggtgccgtcactgggcaccgaattgtcgaacgagccggcgttgttcgag
gaggtctggtcgtgggggacaaaggtactgaaattggatgagcaattggattccgtccgc
aacgcgacggcagccgaatga

DBGET integrated database retrieval system