KEGG   Mycobacterium sp. JS623: Mycsm_04508
Entry
Mycsm_04508       CDS       T02423                                 

Definition
(GenBank) oxidoreductase, SDR family
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00903  Limonene and pinene degradation
msa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycsm_04508
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mycsm_04508
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF5010
Other DBs
NCBI-ProteinID: AGB24744
UniProt: L0J0A6
Position
complement(4448702..4449538)
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRSHAVRLAQEGADIIAVDICRPFADSPAPPATPEDLAETA
DLVKALDRRIVTAEVDVRDYELLKQAVDSGVEQLGRLDIVVANAGIGTIGTRLDRMKEDI
WQEMIDVNLAGVWKSVKAGVPHLLAGGRGGSIILTSSVAGLKTYPHTGHYVAAKHGVVGL
MRTFAVELGAHSIRVNSVHPTHVNTPLLHNEQTYRMFRPDLENPGPDDMAPVCQTFHMLP
IPWVTAEDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggtcgggtagagggcaaggtcgcgttcatcaccggcgcggcgcgcggccaggga
cgcagtcacgcggtgcgcctggcgcaggaaggcgccgacatcatcgccgtcgacatttgc
cgacccttcgccgactcgcccgctccgccggcaactcccgaagacctcgccgagaccgct
gacctggtcaaggcgctggatcgccgcatcgtcaccgccgaggtcgacgtccgcgactat
gagctgctgaagcaggccgtcgacagcggagtcgaacaactgggccgattggacatcgtc
gtcgccaacgccggcatcggaacgatcggaacccggctcgaccggatgaaggaagacatc
tggcaggagatgatcgacgtcaacctcgccggcgtgtggaagtcggtcaaggccggcgtt
ccgcatctgctggccggcggccggggcgggtcgatcatcttgaccagttcggtcgcaggg
ctcaagacctacccgcacaccggtcactatgttgcggcaaaacatggcgtcgtcgggttg
atgcggacgttcgccgtcgaactcggggcgcactccatccgcgtcaactccgtgcatccg
acgcatgtgaacacaccgctgctacacaacgagcagacgtaccggatgttccggccggac
ctggagaacccgggccccgacgacatggcgccggtctgccagaccttccacatgctgccc
atcccgtgggtgaccgctgaagacattagcaacgcggtgctgttcctcgcgtccgacgag
gcccggtacatcaccggcgtcacgcttcccgtcgacgcgggcagctgcctgaagtaa

DBGET integrated database retrieval system