KEGG   Mycobacterium sp. JS623: Mycsm_05286Help
Entry
Mycsm_05286       CDS       T02423                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00071  Fatty acid degradation
msa00072  Synthesis and degradation of ketone bodies
msa00280  Valine, leucine and isoleucine degradation
msa00310  Lysine degradation
msa00362  Benzoate degradation
msa00380  Tryptophan metabolism
msa00620  Pyruvate metabolism
msa00630  Glyoxylate and dicarboxylate metabolism
msa00640  Propanoate metabolism
msa00650  Butanoate metabolism
msa00900  Terpenoid backbone biosynthesis
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
msa01212  Fatty acid metabolism
msa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_05286
   00630 Glyoxylate and dicarboxylate metabolism
    Mycsm_05286
   00640 Propanoate metabolism
    Mycsm_05286
   00650 Butanoate metabolism
    Mycsm_05286
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_05286
   00072 Synthesis and degradation of ketone bodies
    Mycsm_05286
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycsm_05286
   00310 Lysine degradation
    Mycsm_05286
   00380 Tryptophan metabolism
    Mycsm_05286
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycsm_05286
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_05286
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mycsm_05286
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msa04147]
    Mycsm_05286
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mycsm_05286
Exosome [BR:msa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycsm_05286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGB25484
UniProt: L0J2F2
Position
complement(5242390..5243910)
Genome map
AA seq 506 aa AA seqDB search
MVDPRTPVVVGVGQFTERIDDADYRGMSAVDLAAAAVSAALADTGAAGVAMAVDTVFGLR
QFEISGPMPAALGKSNNYPRSVMRRVGGDPARVVLEPVGGQSPQKLVTEAGNAIAAGEAD
VVMIMGSEPGSTARYFANRDDKPDFTEHIEGQLEDRGHQIFSYIDDYTIQHGLTGAPVQY
GLLENARRARLGLSVADYRREMAELFAPLSKVAAKNPFSSSPVERSVEEILTVTDDNRMI
CDPYPRLLVARDQVNQGAAAVMMSVEAARRLGVPKEKWIYVHGHSDMVEQATLDRADLGA
SPASVLAVREALRVAEIGVDDIATFDLYSCFPFPVFVISEALGIDGDDPRGLTLTGGLPY
FGGPGNSYSLHAIAETVNEMRQTPGRFGFVGANGGIMSRYSVGIYSTAPVEWHTDRSEAL
KREIAALPKVPVTKNPDGAATIETYSVRYDWPIRTGIIVGRLDSDNSRFMATTEDDDLVA
LMSDGDPLGAAISVWSTDNGNRASLA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatccgcgcactccggtggttgtcggggtcggccagttcaccgagcgcatcgac
gacgccgactatcgcggcatgtcggcggtggacctggcggcggccgcagtgtcggcggcg
ctggcggacaccggcgctgccggagtcgccatggccgtcgacacagtcttcgggctgcgg
cagttcgagatctcaggaccgatgcctgccgcgttgggcaaatcgaacaactatccacga
tcggtcatgcgacgcgtcggtggcgatcccgcgcgcgtggtgctggaacccgtcggggga
caaagcccgcagaagctcgtgactgaggctggcaacgcgattgcggcgggcgaggccgac
gtcgtgatgatcatgggctccgagccggggtcgacggcgcgctacttcgccaatcgggat
gacaagccggatttcacggagcacatcgagggtcaactcgaggaccgcggccatcagatc
ttcagctacatcgacgactacaccattcagcacggcctgaccggcgcgccggttcagtac
gggctgctcgaaaatgcccgccgggcacggctcgggctcagcgtcgccgactatcgccgc
gagatggccgaactcttcgccccactgtcgaaagtggctgcgaagaacccgttttcgtcc
tcgccggttgagcgttcggtggaggagatcctcaccgtcactgacgacaaccggatgatc
tgcgacccatatccgcgtctgcttgtcgcacgcgatcaggtcaaccagggcgccgccgcg
gtcatgatgtccgtcgaggcggcccgacgactaggcgtgcccaaggaaaagtggatctac
gtgcacggccattcggacatggtcgagcaggcgacgctggaccgcgccgacctcggcgcc
agccccgcatcggtgctggctgtgcgagaagccttgcgggtggctgagattggcgtcgac
gacatcgccaccttcgatctctacagctgcttcccgttcccggtcttcgtcatcagcgag
gccctcggcatcgacggtgacgatccgcgcgggctgacgctgacaggcggcctgccgtac
ttcggcggccccggtaacagctactcgctgcacgcaatcgccgagacagtgaacgaaatg
cgccagacgccagggcgattcgggttcgtcggcgccaacggcggcatcatgagcaggtac
tccgtcggcatctactccaccgcgcccgtcgaatggcacaccgaccgcagcgaggcgctg
aagcgagagatcgccgcactaccgaaggtgcccgtgacaaaaaatcccgacggcgccgcg
accatcgagacctactcggtgcgctacgactggccgatccgcaccggcatcatcgtcggc
cgcctcgactccgacaacagccggttcatggccaccaccgaagacgacgacctggtcgcg
ctgatgtccgacggcgatcccctgggcgccgcgatcagcgtgtggtcgaccgacaacggc
aaccgcgctagcctcgcttag

DBGET integrated database retrieval system